[ 3 / biz / cgl / ck / diy / fa / ic / jp / lit / sci / vr / vt ] [ index / top / reports / report a bug ] [ 4plebs / archived.moe / rbt ]

2022-05-12: Ghost posting is now globally disabled. 2022: Due to resource constraints, /g/ and /tg/ will no longer be archived or available. Other archivers continue to archive these boards.Become a Patron!

/vt/ - Virtual Youtubers


View post   
View page     

[ Toggle deleted replies ]
File: 236 KB, 1448x2048, FW4uTaKVQAA5gK1.jpg [View same] [iqdb] [saucenao] [google]
28238266 No.28238266 [Reply] [Original]

Nijisanji EN Youtube channels:
https://www.youtube.com/channel/UC-JSeFfovhNsEhftt1WHMvg/channels

Twitter:
https://twitter.com/NIJISANJI_World
https://twitter.com/i/lists/1415262975435231235

Lazulight:
https://twitter.com/PomuRainpuff
https://twitter.com/EliraPendora
https://twitter.com/3W1W4 (alt)
https://twitter.com/FinanaRyugu
https://twitter.com/RyuguFinana (alt)

Obsydia:
https://twitter.com/Rosemi_Lovelock
https://twitter.com/Petra_Gurin
https://twitter.com/Selen_Tatsuki

Ethyria:
https://twitter.com/MillieParfait
https://twitter.com/EnnaAlouette
https://twitter.com/NinaKosaka
https://twitter.com/ReimuEndou

Luxiem:
https://twitter.com/Ike_Eveland
https://twitter.com/Mysta_Rias
https://twitter.com/Vox_Akuma
https://twitter.com/Luca_Kaneshiro
https://twitter.com/Shu_Yamino

Noctyx:
https://twitter.com/sonny_brisko
https://twitter.com/uki_violeta
https://twitter.com/alban_knox
https://twitter.com/fulgur_ovid
https://twitter.com/yugo_asuma

Teamup schedule for Nijisanji EN:
https://teamup.com/ks1mraas71v3fjf1c2
https://walfie.github.io/niji-en-pinned/
https://nijien.vercel.app/

To watch streams at the same time:
https://holodex.net/
https://pomuhub.com/
https://niji-mado.web.app/home
Open devtools (F12 key), go to console tab, input the following code, then refresh the page.
localStorage.setItem('rulePauseOther', 0);
You only need to do this once, or until your browser data is cleared.

NijiEN song playlist:
https://youtube.com/playlist?list=PLKN0vyOK8SHelderZX3Vb84zwoAWoTKwR
To loop indefinitely get a browser extension preventing Youtube autopause.

Nijisanji chat log:
https://niji.chats.ninja/#/comment

Aggie archive:
https://catbox.moe/c/hp31z6

Our Minecraft Server:
ninisani.moe

Reminder to ignore bait, shitposting, samefags, discordfags, numberfags, tribalfags and falseflaggers.

Previous thread: >>28233566

>> No.28238281

>>28238266
I just got into the stream
I just wanna say Sukoya's voice is really hot

>> No.28238284
File: 951 KB, 2879x3928, 94561992-7E78-4561-A229-4AC7FAE66063.jpg [View same] [iqdb] [saucenao] [google]
28238284

Luca love!

>> No.28238287
File: 491 KB, 2048x1281, 1631263120113.jpg [View same] [iqdb] [saucenao] [google]
28238287

Sonny LOVE!

>> No.28238288

has sonny fucked sukoya yet

>> No.28238289
File: 281 KB, 439x514, 1657857328793.png [View same] [iqdb] [saucenao] [google]
28238289

SONNY LOVE MANIFEST HE STREAMS TF2 MORE

>> No.28238290
File: 533 KB, 1451x2048, FXmmLuDXwAEfZYV.jpg [View same] [iqdb] [saucenao] [google]
28238290

Ike love!

>> No.28238291

>>28238169
it's either that, a one night stand, or you also have to be a crossdresser for them to date you

>> No.28238303
File: 532 KB, 2160x2160, 1630766946036.jpg [View same] [iqdb] [saucenao] [google]
28238303

<3

>> No.28238305
File: 363 KB, 1530x2048, FON0LyGakAYiMpz.jpg [View same] [iqdb] [saucenao] [google]
28238305

Mysta love!

>> No.28238308

sonny
more like
bonny

>> No.28238312

>>28238288
he and Alban doubleteamed her

>> No.28238313
File: 225 KB, 1448x2048, FXYv8-5aMAcBfRF.jpg [View same] [iqdb] [saucenao] [google]
28238313

>>28238305
Mysta love!

>> No.28238319

>>28238308
so true

>> No.28238320

>>28238288
he's too busy being pschotic and gay with alban

>> No.28238324
File: 303 KB, 506x496, 1657624496254.png [View same] [iqdb] [saucenao] [google]
28238324

Vox (forma de koushien)

>> No.28238330
File: 140 KB, 1920x1080, D1751060-72B1-4DCD-AA4F-0726616FA32C.jpg [View same] [iqdb] [saucenao] [google]
28238330

sonny love! (and i am manifesting for his next karaoke to happen soon)

>> No.28238339
File: 512 KB, 2048x1448, 460C7F98-B368-466D-AA14-4E3DF76CA687.jpg [View same] [iqdb] [saucenao] [google]
28238339

I'm reading the thread even though I'm at work and getting depressed that I can't watch Mysta being cute...

>> No.28238340

>Kei_16GB
Is this a pun or something?

>> No.28238345

Leos still keeps getting mad because his students keep going for studies instead of baseball. He looked at their grades and most of them are A so he made a joke that they're all aiming for Tokyo Uni or Cambridge

>> No.28238347
File: 49 KB, 250x250, Petralove.png [View same] [iqdb] [saucenao] [google]
28238347

>>28238141
Don't give up Pomie. Just focus on yourself. The more you chase something the more it gets away from you. Just take care of yourself first. A relationship won't save you from being miserable.

>> No.28238361
File: 101 KB, 800x800, FBqu45RVUAUz3nf.png [View same] [iqdb] [saucenao] [google]
28238361

>> No.28238362
File: 3.92 MB, 2896x4096, E89C4FCC-34D5-4402-99B0-A8ACAE40EB5A.jpg [View same] [iqdb] [saucenao] [google]
28238362

P o n t o

>> No.28238364
File: 607 KB, 2300x1400, FXY_kzeUYAUoSue.jpg [View same] [iqdb] [saucenao] [google]
28238364

Alban love!!

>> No.28238369
File: 448 KB, 1752x2048, IMG_20220712_113404.jpg [View same] [iqdb] [saucenao] [google]
28238369

>>28238169
i have had experience with cd's and youre right for the most part, i have had a one night stand with one and it felt great tho
>>28238128
i dont think i mind people who wants their oshi to be more successful because its a win-win situation for both the viewer and the liver but i dont like that it is the sole focus, i watch myamya because she's super adorable, i love her sketches in the niji shows too, she's funny. i dont look at subcounts myself

>> No.28238374

>>28238362
N

>> No.28238379

MAYUYU MURDER SPREE

>> No.28238390

>>28238339
It's time to become a NEET again, sis.

>> No.28238391

>>28238374
E

>> No.28238402

>sonny is crazy man

>> No.28238405

Sonny is crazy man

>> No.28238409
File: 1.01 MB, 1200x1600, d7abc13f9e3950196ecd7b17381e2261.jpg [View same] [iqdb] [saucenao] [google]
28238409

>>28238374
E

>> No.28238420

was sukoya surprised that sonny is crazy?

>> No.28238421

>>28238390
I would if I could man, I really would

>> No.28238424

> sonny is a crazy man

hes not lying

>> No.28238427

>>28238324
did they do nina ?

>> No.28238431
File: 643 KB, 2000x1241, FRXZSEmVEAAtQ5n.jpg [View same] [iqdb] [saucenao] [google]
28238431

sonnyban LOVE! Nagao will now have ptsd whenever he sees Noctyx.

>> No.28238432
File: 417 KB, 1424x1906, 1635576178193.jpg [View same] [iqdb] [saucenao] [google]
28238432

>Sonny is crazy man

>> No.28238435

>>28224393
>0 mods show up when niji males announced

>> No.28238439

>>28238409
GI!

>> No.28238441

>>28238339
Hang in there, the vod will be there. I was going to sleep and catch up on the vod, but I already fell asleep earlier while watching tf2 and woke up an hour before so eh...

>> No.28238449
File: 158 KB, 1000x1000, 1633813867217.jpg [View same] [iqdb] [saucenao] [google]
28238449

Nina Love!

>> No.28238468

>>28238435
that meido was busy samefagging because he wanted a male split

>> No.28238485

a good recovery last game after that horrible game with horrible villains

>> No.28238492
File: 177 KB, 1934x2048, FXjS_MeaIAEVvqB.jpg [View same] [iqdb] [saucenao] [google]
28238492

aikou love!

>> No.28238493

>>28238420
I mean, Sonny was laughing maniacally when he killed her with Alban

>> No.28238504

>>28238435
hololive was a mistake

>> No.28238517
File: 513 KB, 1964x2048, 1643963014331.jpg [View same] [iqdb] [saucenao] [google]
28238517

>>28238431
I mean, he keeps saying he'll kill Yugo... Sonny and Alban just protecting their kyou--I mean, wavemate.

>> No.28238520

>>28238468
so, whats the verdict?
will it be split or will they discuss it in the same general??

>> No.28238529
File: 472 KB, 746x726, 1657718621816.png [View same] [iqdb] [saucenao] [google]
28238529

>>28238492
I miss him.

>> No.28238530

>>28238435
if you havent noticed the mods and jannies are all biased faggots

>> No.28238545

>>28238520
don't know, don't care. i watch nijisanji

>> No.28238556

>>28238504
They were needed to contain the schizos. But they keep breaking containment

>> No.28238559

I'm happy some of the EN members were able to play with Mayuzumi before he graduates :')

>> No.28238582

>>28238559
:'(

>> No.28238597

>>28238530
maybe we can do somethi

(USER WAS BANNED FOR THIS POST)

>> No.28238598

for some reason alban's stream keeps buffering for me while everyone else's is fine

>> No.28238603

Is it wrong for me that I like anons arguing about Nijisanji last thread over any /soc/ and vocaroo posts?

>> No.28238613

>>28238598
weird, it's playing fine for me

>> No.28238617

>>28238603
yes

>> No.28238623

>>28238603
yeah

>> No.28238624

>>28238492
>>28238529
;__;

>> No.28238626

>>28238435
I fucking hate these biased nigger mods so much

>> No.28238635

>>28238603
yes

>> No.28238636

>>28238597
I fucking pray one of you idiots become a janny and try to watch these threads

>> No.28238638

>>28238603
you can filter both so who cares

>> No.28238643

>>28238603
no

>> No.28238654

>>28238559
Can he come back like Sasaki when what bothered him disappear?

>> No.28238677

>>28238613
i can't even watch him properly on phone data wtf

>> No.28238678
File: 361 KB, 1536x1786, FSZETYcaIAAzPA5.jpg [View same] [iqdb] [saucenao] [google]
28238678

>>28238624
Time is moving too slow.

>> No.28238680

>>28238617
>>28238623
>>28238635
commit die

>> No.28238686

>>28238654
I believe he's graduating completely.

>> No.28238687

>>28238603
that argument has been looped ten times over idc regardless anymore

>> No.28238695
File: 335 KB, 1536x1536, IMG_3409.jpg [View same] [iqdb] [saucenao] [google]
28238695

cute collab! such a good well-rounded roster.

>> No.28238696

>>28238636
If I become jannie, I will probably become biggest bias nigger ever and remove all the briskadets post until they stop posting

>> No.28238697

>>28238582
so glad the imposters won that last round with mayuyu finishing off the last survivor. perfect way to end the stream.

>> No.28238704

Mysta is going to cook (a meal for me)

>> No.28238711

>>28238686
; ;

>> No.28238719

>>28238654
his roommate's channel has been active lately so i guess he's just going to the flesh tuber route

>> No.28238720

>>28238654
he's not deleting his channel so there's a chance
he also said he's 99.99% done, though

>> No.28238723

I will marry Mysta Rias.

>> No.28238733

>>28238677
I don't even have his stream on a lower quality and I'm casting to a smart TV so that is really weird, I'm sorry he's refusing to behave for you

>> No.28238734

Sonny's gone, but at least he's starting early tomorrow so I can have dinner, sleep and wake up to a stream. I love him so much. Otsonny!

>> No.28238735

>>28238517
Pain..I'll have to get used to the 'no kyodai' thing.

>> No.28238736

>>28238723
Sorry, he's already married to me.

>> No.28238744

>>28238678
Time moves slow when you wait and keep thinking about him. It’s time to find something else to keep you busy…

>> No.28238754
File: 101 KB, 300x300, 1657788280102.png [View same] [iqdb] [saucenao] [google]
28238754

>>28238696
im innocent

>> No.28238765

Its not fair...
I was supposed to be the psychopath of Niji EN... Not Sonny

>> No.28238782

>>28238735
I may be going schizo, but did Sonny or Alban mention the onii/otouto thing at all during the collab?

>> No.28238788

>>28238345
>nerd but hate school
>professor
Leos......

>> No.28238792

>>28238765
You'll just have to one up him

>> No.28238794

>>28238696
It's never worth being moderation.

>> No.28238806

>>28238736
Proof?

>> No.28238818
File: 361 KB, 478x537, 1642788344416.png [View same] [iqdb] [saucenao] [google]
28238818

>>28238369
I almost had a relationship with a Touhou crossdresser but I just couldn't take how narcissistic he was. It was really frustrating how physically attracted I was to him in cosplay when he was rping as the characters or doing a photoshoot. But when he took it off he had a very vile personality that made me stop talking to him before we ever had sex due to how often he'd shit on people for not being as pretty as him or start verbal slapfights with random strangers, especially women, just because they were breathing the same air as him.

In hindsight I should've just sucked up my pride and taken the chance to lose my virginity. I still fap to some of his Marisa sets from time to time tho.

>> No.28238819

Sorry Kindreds
no Mr.coom stream
https://twitter.com/Vox_Akuma/status/1547905473126379521

>> No.28238823

I thought vox bought a house for himself why did he have a roommate all of a sudden

>> No.28238824
File: 585 KB, 2000x3000, FVJB3cNVsAE_wTu.jpg [View same] [iqdb] [saucenao] [google]
28238824

Finana anal

>> No.28238836

>>28238696
But I post using a female nijiEN chuuba image.

>> No.28238838
File: 360 KB, 1638x2048, FJthOAWXIAQkuc_.jpg [View same] [iqdb] [saucenao] [google]
28238838

Bye for now Mysta... I think I'll try and nap for an hour before the goat simulator

>> No.28238842

>>28238782
Playing out their kink in an international collab isn't the politest of things to do i-it's just that, right?

>> No.28238847

>>28238788
he's not a prof he's a scientist who makes drugs

>> No.28238851
File: 5 KB, 346x39, 1638761143283.png [View same] [iqdb] [saucenao] [google]
28238851

>>28238818
nice blog

>> No.28238853

>>28238823
he was Helping a roommate
probably an old friend when he left

>> No.28238855
File: 137 KB, 671x1100, FQbrrc2VsAQzvPa.jpg [View same] [iqdb] [saucenao] [google]
28238855

>>28238744
No. I want to suffer if it's for him. Waiting is not the worst thing that could've happened. And I'm actually excited today, Reimu-chan's cover is going to premier in just a few hours.

>> No.28238856
File: 2.09 MB, 4096x4096, Blanket.png [View same] [iqdb] [saucenao] [google]
28238856

>>28238695
Yeah it was really fun! Seems like everyone had a good time and Alban was more confident with speaking jp. So happy I stayed up until 4:30 am to watch it.

>> No.28238882
File: 154 KB, 936x1164, FIHCZuxUcAIbV9o.jpg [View same] [iqdb] [saucenao] [google]
28238882

Mysta's gone... He was so cute this morning! Can't wait for his next stream.

>>28238838
I was considering a nap as well, but now I'm wide awake... Guess I'll do some work.

>> No.28238887

>>28238842
>spoiler
didn't they do it during the jp valorant stream?

>> No.28238888
File: 40 KB, 512x508, 1657778845254.jpg [View same] [iqdb] [saucenao] [google]
28238888

>>28238823
He has a girlfriend, she relocated from Hong Kong.

>> No.28238892

>>28238696
They're the most annoying posters I've seen in this thread. They singlehandedly managed to make me annoyed just by seeing the guys face now and that's something no other group has achieved.

>> No.28238894

>>28238818
>start verbal slapfights with random strangers, especially women
Gay men are usually giga misogynistic

>> No.28238895
File: 251 KB, 1200x845, F5A1C51A-C8A6-4A43-A786-03BCAD3526D2.jpg [View same] [iqdb] [saucenao] [google]
28238895

Time to watch leos. How is Shu doing? I was watching the project winter collab

>> No.28238899

>>28238719
>>28238720
Yeah I know but mayuyu is not like his roommate so we really going to lose him after he graduate and I thought he would come back since he will not delete anything and that the only issue he had was with the way anycolor wants to go with the vtuber mayuzumi Kai. But if he really decide to go so be it but I'm really gonna miss him.

>> No.28238916

Sukoya collanbng with EN is so nice.
Now it's time for Hoshikawa to do the same.

>> No.28238918

Is there a way to enjoy male VTubers without being demonized by literally everyone

>> No.28238934

>>28238887
yeah they did but there's potential that they reliased that maybe they were taking it too far

>> No.28238938

>>28238823
He didn't buy a house, he's renting. It sounds like he helped his old roommates move, but it doesn't mean they moved with him.

>> No.28238946

>>28238918
Just dont read the thread and look at the board retard

>> No.28238949

>>28238899
what did anykara want to do with mayuzumi kai? i'm actually lost

>> No.28238969

>>28238895
His stats are still pretty bad but Leos keeps using him as the pitcher for the 9th innning to train him

>> No.28238975

>>28238949
Dunno but it was creative differences that made him graduate

>> No.28238976

>>28238918
be male first and foremost

>> No.28238987

>>28238918
Do it in your own corner out of the sight of everyone else like the nijimale thread.

>> No.28238998

>>28238918
Get off 4chan and get on literally any other social platform.
The view of this place is a very small minority that is disconnected with reality.

>> No.28239021
File: 49 KB, 950x950, F46258A0-5F71-467D-90BE-43AC3AA1212F.jpg [View same] [iqdb] [saucenao] [google]
28239021

>>28238855
Understandable, I couldn’t take my mind off my oshi during the worst of times even if I wanted. I just hope that you can keep it in moderation so it doesn’t drain you too much

>> No.28239031

uwaah i hope sonny gets to collaborate more with his jp senpai

>> No.28239037

>>28238918
grow a fucking spine

>> No.28239044
File: 1.98 MB, 1170x2532, 1630700909191.png [View same] [iqdb] [saucenao] [google]
28239044

https://www.youtube.com/watch?v=pQmpjFmB9yg

>> No.28239046

>>28238899
Maybe he'll come back if anykara backpedals on their numberagotry new policies.

>> No.28239048
File: 283 KB, 1448x2048, 64D7CF78-91FD-4A6D-9D38-87ABBE3FF394.jpg [View same] [iqdb] [saucenao] [google]
28239048

Good morning!! Milord LOVE!!

>> No.28239060
File: 202 KB, 1451x1664, A72EA530-A965-4DBC-9296-0A94FFF52029.jpg [View same] [iqdb] [saucenao] [google]
28239060

>>28238969
Ganbare shubert…

>> No.28239068
File: 87 KB, 840x1033, 20220715_063657.jpg [View same] [iqdb] [saucenao] [google]
28239068

I love Seffyna she is my beautiful seiso K-Fairy gf
(ง -᷄ω-᷅ )ว ٩( -᷄ω-᷅ )۶(ง-᷄ω-᷅ )ว ( -᷄ω-᷅ و(و

>> No.28239077

Mayuyu still has a collab on 24th where he might invite international livers for a linguistics radio stream. It's basically a podcast discussing language

>> No.28239080

>>28238975
that's...sad. i thought he just wanted to quit which is much more understandable

>> No.28239103

>>28239044
https://www.youtube.com/watch?v=-B2yzG6Gj0A

>> No.28239118
File: 144 KB, 650x500, FWJugHpUcAAA8AM.png [View same] [iqdb] [saucenao] [google]
28239118

>>28239021
As soon as he comes back, everything will be okay again. Thank you.

>> No.28239122
File: 196 KB, 1777x1360, BF0C9979-4C5A-4520-80CE-CAC2961E7E7B.jpg [View same] [iqdb] [saucenao] [google]
28239122

>>28239048
Good morning!

>> No.28239127
File: 345 KB, 1700x1519, aikou.jpg [View same] [iqdb] [saucenao] [google]
28239127

>>28238492
i hope he's having a lot of fun.. i miss him so much.

>> No.28239129

>>28238949
It's all just rrats and speculation but my personal take is he wanted to spend his earnings on some grand ARG game but management wouldn't give him permission to do anything that involves a real life ARG so he bailed.
In hindsight w/ Abe's assassination I think a real life ARG would've had the potential to be a disaster like the Aqua Teen Hunger Force one so maybe it was for the best.

Keep in mind that's just my baseless speculation though and he's never said anything about it.

>> No.28239140

>>28239048
gm, the stream today seems ike it'd be fun!

>> No.28239146
File: 265 KB, 1181x1748, 1640111128294.jpg [View same] [iqdb] [saucenao] [google]
28239146

>>28238744
Even in his absence I am unable to think about anything else, and even if I could, it would feel wrong. He is more valuable than anything in this world.

>> No.28239148

>>28238918
Use a male split or get an extension / kurobaex which allows you to filter and hide reply chains manually and by keyword

>> No.28239152
File: 306 KB, 1191x1684, 1629670397021.jpg [View same] [iqdb] [saucenao] [google]
28239152

>>28239103
https://www.youtube.com/watch?v=Niaw3Ez0YLU

>> No.28239167
File: 138 KB, 1383x988, FHW3KUZVUAAkO8b.jpg [View same] [iqdb] [saucenao] [google]
28239167

fun stream

>> No.28239170

>>28239140
oh wait...

>> No.28239181

I'm going to have sex with Mysta Rias.

>> No.28239190
File: 230 KB, 1600x2316, 1657885246368.jpg [View same] [iqdb] [saucenao] [google]
28239190

>>28239140
Cancelled. Milord needed his rest. Stupid workaholic demon. Love him so much.

>> No.28239205

>>28238918
Use /luxnoc/ or make your own imageboard or go to female-dominated imageboards like lolcow.
Or just join the fan discords I guess.
I'm not a woman but as a Nijifag on 4chan I'm so used to people shitting on the vtubers I like that it doesn't bother me.

>> No.28239206
File: 42 KB, 200x200, 1645838508971.png [View same] [iqdb] [saucenao] [google]
28239206

>>28239048
good morning

>> No.28239217

So the Shoto faggot will fuck off from now on and goes to leech holostarEN instead? Seem like a win for me

>> No.28239223
File: 30 KB, 381x366, 1646034198370.jpg [View same] [iqdb] [saucenao] [google]
28239223

>>28238918
what do you mean "enjoy" male vtubers? Are you dating one of them? I can't believe you'd do this, anon. we all feel a great sense of betrayal.

>> No.28239226

>>28239190
I just saw, it's a shame but I hope he gets a good rest

>> No.28239241

>>28239205
fan discords are full of underaged girls even i cant handle something like that

>> No.28239246

>>28239129
Wonder if he'll go to another corpo for his visions.

>> No.28239249

>>28239217
shoto's ties to niji en are older than niji en itself, we'll never be rid of him

>> No.28239255

>>28238918
No, this is a hobby dominated by straight guys

>> No.28239260

>>28239205
It really doesnt take much to get desensitized to it honestly

>> No.28239271
File: 261 KB, 1200x840, 6ED8EED7-BB5E-4335-A044-80C359BB0B53.jpg [View same] [iqdb] [saucenao] [google]
28239271

>> No.28239272

>>28239217
I hope so, let him leech someone else, if even for a little bit.

>> No.28239291

>>28239271
All those women in that picture...

>> No.28239318

>>28239272
I think rather than leech, he’s going to promote them instead

>> No.28239325

Just got home. How was the project winter collab? Whose POV is good to watch?

>> No.28239327

>>28239249
Man, I hate Elira and her friends so much

>> No.28239331

>>28239271
with some artstyles you can just tell the artist mostly draws porn

>> No.28239341
File: 492 KB, 600x643, 12344562463546.gif [View same] [iqdb] [saucenao] [google]
28239341

>>28239048
Good morning, have a good day

>> No.28239345

>>28239325
fun kek i only watch sonny's pov so cant really say which is the best.

>> No.28239349
File: 173 KB, 1221x752, EA558CB8-6CA9-440F-A6EE-884D7E146396.jpg [View same] [iqdb] [saucenao] [google]
28239349

>> No.28239362

Leos said that worst case, his players all go to Tokyo Uni. His village is full of introverts that focus on studying for uni entrance exams instead of baseball.

>> No.28239367

>>28239325
Penny betrayal and Sonnyban went schizo

>> No.28239372

>>28239325
I only watched alban but no matter who you pick, for the last round, watch either him or sonny.

>> No.28239393

>>28239331
So that's why I felt like a sense of similarity and deja vu.

>> No.28239394

>>28239318
just watch him stop collab with nijiEN once holostarEN becomes bigger than nijiENmales like wha happened with Shigure Ui and other holowhores

>> No.28239406

>>28239325
It was fun. I'd go with Petra or Alban for the funniest moments, but every perspective was good. I was actually paying the most attention to Mayuyu, so you might enjoy his as well.

>> No.28239408

>>28239217
no. he’ll leech both nijiEN and starsEN for maximum output.

>> No.28239429

https://twitter.com/Mysta_Rias/status/1547910218524176385

>> No.28239433

>>28239394
Oh, I’ll be happy of that were to happen

>> No.28239441

Woke up an hour too early

>> No.28239450

>>28239441
go back to sleep then dummy

>> No.28239454

>>28239271
LIZE SEX

>> No.28239460

>>28239362
Oof…

>> No.28239493

>>28239362
thats kind of cute actually

>> No.28239495

>>28239429
>Cute Mysta tweet
>Shoto making it sexual in the replies
Every fucking time

>> No.28239497

>>28239271
Mysta's wide hips...

>> No.28239503

>>28239441
stick around for natsume's 3d

>> No.28239505

>>28239406
>>28239372
>>28239367
>>28239345
Thanks. I'll catch up with the vods

>> No.28239506

>>28239394
You guys are just making StarsEN's potential success sound better and better. God I hope they blow up and become super popular.

>> No.28239514

Merry Christmas, Seffyna

>> No.28239515

>>28239497
Perfect for breeding…

>> No.28239521

Dead hours... should i watch tokyo godfathers or paprika

>> No.28239542

>>28239362
>shu
>oliver
>axia
>kaede
>kaida
>salome
I kinda understand why

>> No.28239545

This is /NijiEn/ thread, use your damn thread to discuss it

>> No.28239550

>>28239521
Watch Resident Evil

>> No.28239551

>>28239515
I want to put a baby in him...

>> No.28239552

>>28239521
do some push ups

>> No.28239572

>>28239362
>his team has nerd virgin loser, virgin loser, professor, ojou sama rp, jk and Japanese men who do not speak Japanese fluently
Leos.....

>> No.28239578

>>28239521
seffy is doing karaoke if you're interested

>> No.28239580

>>28239552
I already did my daily jogging reps...

>> No.28239604

>>28239503
I will now

>> No.28239641

I'm not even a quilldren but man, I really wish Ike was streaming right now

>> No.28239650
File: 728 KB, 1448x2048, FXs9P5-UIAEtjkn.jpg [View same] [iqdb] [saucenao] [google]
28239650

>> No.28239662
File: 289 KB, 598x778, 1657573388849.png [View same] [iqdb] [saucenao] [google]
28239662

>>28239521
Time for VODs for me. I want to see some sheep.

>> No.28239677

>>28239662
She’s a cutie.

>> No.28239680

>>28239641
I do too.

>> No.28239683

>>28239545
Townbike of /vt/....

>> No.28239684

>>28239650
Enna and Reimu?

>> No.28239729

https://twitter.com/Naraka_2434/status/1547911272423116801

>> No.28239738

>>28239683
I can’t believe we’re all whores…

>> No.28239747
File: 103 KB, 736x1308, 1657617694623.jpg [View same] [iqdb] [saucenao] [google]
28239747

Nijidead

>> No.28239755

I have a recurring dream/nightmare that I’m having sex and just take a fat piss in a girl. What’s wrong with me /nijien/?

>> No.28239767
File: 593 KB, 1798x1989, FU3Ze6PaIAIeZVP.jpg [View same] [iqdb] [saucenao] [google]
28239767

>>28239429
I cooked his favourite tomato soup yesterday, he's bound to love it. Open wide~~

>> No.28239768

>>28239362
>>28239542
To be clear, village of introverts refers to the fact that majority of the players and npcs Leos rolled all had the 内気 Shy personality not the personalities of the livers themselves

>> No.28239772

>>28239729
Roco could've been the 5th member

>> No.28239793

>>28239255
Guys who frequently fap to cross players and traps

>> No.28239805
File: 2.62 MB, 498x398, clint-eastwood-cowboy.gif [View same] [iqdb] [saucenao] [google]
28239805

>>28239545
/NijiEN/ is the wild west, pilgrim.

>> No.28239806

>>28239755
empty your bladder before going to bed

>> No.28239823

I feel like everyone always underestimates Mysta. It makes me prouder when he accomplishes things.

>> No.28239827

>>28239755
Why not pee in their butts?

>> No.28239835

>>28239641
to think there used to be a time where he hardly streamed or had more than one rest day.. it's hard to get used to him being on break now.

>> No.28239842
File: 132 KB, 1696x954, 1635504670370.jpg [View same] [iqdb] [saucenao] [google]
28239842

>>28239521
Watching Made in Abyss Season 2

>> No.28239846

>>28239217
I wish he leech Holomen, then his fandom going apeshit and cancelling him to graduation

>> No.28239854 [SPOILER] 
File: 87 KB, 1080x1118, 1627037655717.jpg [View same] [iqdb] [saucenao] [google]
28239854

>> No.28239860

https://youtu.be/1uKKrPccLo0

Nachume 3D

>> No.28239876

Why don't we split and make this for NijiEN females only. Samefagging mod said it was ok and the Hololive threads are planning to do that. This shit is stupid having to share the thread with fujos

>> No.28239905

>>28239684
Fuuchan, this is based on their interaction in the trolley collab

>> No.28239908

>>28239823
>It makes me prouder when he accomplishes things
we all feel that for our oshis but also good for him

>> No.28239916

>>28239860
She's already being cute!

>> No.28239921

>>28239876
shut the fuck up holotourist, kys

>> No.28239930
File: 352 KB, 1800x1013, dead_city_-_detail.jpg [View same] [iqdb] [saucenao] [google]
28239930

/NijiEn/ current state
Now Just waiting for someone baiting...

>> No.28239931

>>28239876
Why don't you suck my penis

>> No.28239932

>>28239876
whatever you say meido

>> No.28239933

>>28239860
She looks like she could actually exist.

>> No.28239937

Reimu cover in an hour!

>> No.28239944

>>28239876
Because everyone always spergs out and cries /loe/schizo when an attempt is made. Best you can try to do is try to push the females to their already existing split.

>> No.28239959

>>28239876
*malepregs you*

>> No.28239965

>>28239937
the song itself fucking sucks
why couldn't she choose something else?

>> No.28239976

Look at her go?

>> No.28239986

>>28239876
*Pumps your trembling boywomb full of cum*

>> No.28239989

>>28239908
Of course. It's not a competition after all.

>> No.28239992

>>28239876
dude i agree

>> No.28240002

>>28239876
*gives you an abortion*

>> No.28240008

>>28239944
>push the females to their already existing split
they're alright they can stay. the tourist needs to go tho

>> No.28240013
File: 422 KB, 1164x936, 1655458475267.jpg [View same] [iqdb] [saucenao] [google]
28240013

feeling good today bros

>> No.28240027

>>28239986
Do me next please

>> No.28240029

>>28239876
*malepregs you a 2nd time and then abort it*

>> No.28240034
File: 66 KB, 180x180, 1647934652398.png [View same] [iqdb] [saucenao] [google]
28240034

>>28238918
Everyone gets demonized here. Male, female, trans Vtubers. Don't start this gender shit again.

>> No.28240039

>>28239860
Exposed pits... sex...

>> No.28240049
File: 145 KB, 288x253, 1646563275975.png [View same] [iqdb] [saucenao] [google]
28240049

>>28240013
*kicks ur shin*

>> No.28240055

>>28239876
*feeds you your own aborted fetus*

>> No.28240061

>>28239876
*m.pregs you, aborts your child and eat it*

>> No.28240064

>>28240013
not feeling good yet but looking forward to today

>> No.28240071

>>28240013
I order you to shit up the catalog, aloucreeps

>> No.28240074

i miss natsume's first outfit, bros...

>> No.28240075

>>28239876
take your meds

>> No.28240083

>>28240055
>>28240061
Why are Briskadets like this?

>> No.28240086

>>28240074
I kind of do as well, but this one is really pretty.

>> No.28240087

>>28240049
your heartless assault will do nothing to change my mood, bitch
>>28240071
why would i do that that's mean

>> No.28240106
File: 248 KB, 384x649, 1656557410934.png [View same] [iqdb] [saucenao] [google]
28240106

>>28239876
The amount of (You's) you get will be the number of times oji san cums inside you

>> No.28240113

sucks that mananatsu aren't close with each other
i would love to see mashiro in 3d again

>> No.28240121
File: 563 KB, 500x1246, Kurusu_Natsume_-_Full_Illustration.png [View same] [iqdb] [saucenao] [google]
28240121

>>28240074
ehh
the current outfit is cuter

>> No.28240125

I got gifted my 7th membership....

>> No.28240134

>>28240074
I like this one. It suits her a lot better.

>> No.28240141
File: 205 KB, 1280x1280, 1655548275459.jpg [View same] [iqdb] [saucenao] [google]
28240141

>>28239271
I fucking hope the degen trio gets playing time.

>> No.28240143

>>28239959
>>28240002
>>28240029
>>28239986
I can't wait for women to leave for homostarsEN

>> No.28240144

>>28240125
i haven't got a single one you bitches are lucky

>> No.28240167

>>28240125
whore

>> No.28240168
File: 117 KB, 1726x1169, 1642481432976.jpg [View same] [iqdb] [saucenao] [google]
28240168

>>28240087
*t poses in your general direction*

>> No.28240169

>>28240143
You are now pregnant with my child.

>> No.28240171

>>28240074
The first outfit doesn't suit her personality. This one does

>> No.28240177

>>28240125
How...

>> No.28240187

>>28240143
>>28240106

>> No.28240212

>>28240125
i-i never got gifted with any memberships...

>> No.28240213
File: 73 KB, 220x215, 1637197171521.png [View same] [iqdb] [saucenao] [google]
28240213

>>28240168
go erp with a pomudachi or something

>> No.28240217

>>28240143
They haven't even debuted yet and they're already flops. Barely any promotion. Trailer doesn't have 70k views. Don't count on any "fujoshart femcels" leaving anytime soon.

>> No.28240219
File: 3 KB, 125x125, 1654684387023s.jpg [View same] [iqdb] [saucenao] [google]
28240219

>>28240125
Where's mine...

>> No.28240224

>>28240168
>Cunny
>Does nothing with her cunny model
What's the point of this penguin bitch again? I heard she was supposed to be the Gura killer or some dumb shit like that

>> No.28240248
File: 2.93 MB, 313x336, 1654408885132.gif [View same] [iqdb] [saucenao] [google]
28240248

>>28240213
i dont do that shit fuck you are you mad lmao heheheheheheh
>>28240224
dont talk to me

>> No.28240255

>>28240224
She's cute.

>> No.28240266

Has her light novel been released yet? How's the reviews?

>> No.28240284
File: 103 KB, 850x1478, 4222F975-7177-48E8-9802-89F2A9C83360.jpg [View same] [iqdb] [saucenao] [google]
28240284

What's an alternate outfit you'd like to see your oshi wear?

>> No.28240285
File: 1.72 MB, 2480x3508, 1650017063777.png [View same] [iqdb] [saucenao] [google]
28240285

birb

>> No.28240288

ENTER TENGU

>> No.28240293

Was the propnight collab good ? I didn't know they had one.

>> No.28240302
File: 290 KB, 1920x1080, FXojxYsaQAAnF6b.jpg [View same] [iqdb] [saucenao] [google]
28240302

>>28240171
yeah, i get that. it's cuter and suits her much better, i just personally like the first one a bit more as a design.
i just miss it sometimes... all natsume is cute though.

>> No.28240305

Tengu tits

>> No.28240307

>>28240266
sold enough to warrant a second volume

>> No.28240312

I missed the project winter collab...

>> No.28240315
File: 230 KB, 999x725, 1651310942244.jpg [View same] [iqdb] [saucenao] [google]
28240315

I miss Petora..

>> No.28240333

>>28240217
Watch they have one male with Vox's voice and explode with fujo audience

>> No.28240334

>>28240305
For me, it's the tengu thighs

>> No.28240339
File: 126 KB, 916x1126, 1627808872962.jpg [View same] [iqdb] [saucenao] [google]
28240339

>>28240248
are you mad that i called you out pentomo heheheheh

>> No.28240341

>>28240315
Me too

>> No.28240344

>>28240307
Wonder if there will be an EN fan translation for it.

>> No.28240348

>>28240312
it was boring

>> No.28240350

Knee length skirts really are great, it’s really cute how bouncy it is

>> No.28240361

>>28240333
Unless he's willing to do extremely heavily BFE like Vox he still won't make it.

>> No.28240370

>>28240224
She's cute, retard.
>Gura killer
None of the Niji lolis meme around with their loli status enough though, I agree. Holo kinda dominates on that front.

>> No.28240373

>>28240284
Basketball uniform

>> No.28240374

>>28240293
it was okay. not really amazing or anything, just a normal collab.

>> No.28240381

>>28240361
Still have my fingers crossed waiting for Vox breeding/pregnancy ASMR… please… I need it…

>> No.28240385
File: 133 KB, 1170x864, 1643323323515.jpg [View same] [iqdb] [saucenao] [google]
28240385

>>28240339
im not mad and you didnt call me out
hmph

>> No.28240390

>>28240333
Vox is appealing to female coomers. I don't think any of the stars can do that.

>> No.28240393

>>28240217
trailer doesn't show any designs, that's why

>> No.28240417

>>28240284
military pommers with a tanktop, cargo pants, and boots

>> No.28240418
File: 553 KB, 1170x720, 14664597436.png [View same] [iqdb] [saucenao] [google]
28240418

>>28240339
Don't you have a court appearance for animal abuse to attend to?

>> No.28240422

>>28240381
He said breed yesterday before adding it to the buzzer list...

>> No.28240425

>>28240333
Vox is declining though. Appealing to females is shit and especially when you want to play games and they're not interested in watching you do that.

>> No.28240434

>>28240284
Nude

>> No.28240438

Elira Pendora's big fat sweaty dragon milkers

>> No.28240441

lesbian tengu...

>> No.28240445

>>28240284
i second this >>28240417

>> No.28240446

>>28240425
thats not the case though, Mysta is doing just fine

>> No.28240448

>>28238918
be Japanese

>> No.28240477
File: 253 KB, 2048x2048, 72CB6867-F719-47ED-BFBE-F1416B8DF888.jpg [View same] [iqdb] [saucenao] [google]
28240477

>>28240422
We’re getting closer, sisters… One day he’ll have a “I’m gonna knock you up” subplot in one of his ASMRs, I just know it…

>> No.28240482

>>28240418
>>28240385
i bet neither of you are pentomos

>> No.28240491

>>28239325
Mayuyu is really good at the game so his is great, I'd say just open several POVs and mute according to who's nearby

>> No.28240493
File: 109 KB, 794x669, 1656722552742.jpg [View same] [iqdb] [saucenao] [google]
28240493

>>28240418
I'll show you animal abuse you little penguin

>> No.28240495

Lately I just leave my oshis videos playing 24/7 so I can always hear their voice and don't get lonely.

>> No.28240499

>anime girl promoting her light novel
The future

>> No.28240505

>>28240425
Vox's main appeal was his ASME BFE. He then went on to insult his audience that was into that shit. The other males didn't put all of their eggs in one basket like him and don't have that problem.

>> No.28240509

>>28240495
least lonely pomudachi

>> No.28240517
File: 2.60 MB, 1900x1068, aswefqaewvqawegvqaewgqaweg.png [View same] [iqdb] [saucenao] [google]
28240517

BUY HER BOOK

>> No.28240519

>>28240425
hoeru brothers has a lot of female fans and they are fine

>> No.28240520
File: 1.91 MB, 800x800, 1649763386084.webm [View same] [iqdb] [saucenao] [google]
28240520

>>28240284
Short shorts with a tank top.

>> No.28240527

>>28240495
Mystake?

>> No.28240528

>>28240446
Didn't vox have a menhera moment cause his numbers were dropping? Last time I checked, Mysta isn't Vox, not sure why you brought him up.

>> No.28240542

>>28240284
edgy goth enna

>> No.28240545

>>28240517
>harem romcom higschool setting
>female author
I thought this was just a male thing

>> No.28240556
File: 132 KB, 800x450, 1648259711049.jpg [View same] [iqdb] [saucenao] [google]
28240556

>People ITT already writing of HoloStarsEN

>> No.28240557

>>28240528
being slightly frustrated doesnt mean mental you ding bat

>> No.28240569

>>28240517
I wont it looks bad

>> No.28240575

>>28240528
It's because he wasn't happy with his content lately (and he's not getting enough sleep) also it wasn't menhera, he was just frustrated.

>> No.28240587
File: 261 KB, 946x2048, B31992E5-78FA-4999-82F0-759EDCD6D50C.jpg [View same] [iqdb] [saucenao] [google]
28240587

What sexual fantasy about your oshi did you last masturbate to?

>> No.28240592

>>28240517
Need a scanlation group to pick it up first.

>> No.28240593

>>28240425
Senpai females also like gaming, the reason why it seems like they're not interested with it because the society still repressed them in gaming community, that's why they're reluctant to shows up, some even choose to fake their genders in order to be accepted

If women in general dislike gaming OR if he's declining in gaming content, he'll only reach 1k ccv or even less

>> No.28240604

BLUE

>> No.28240610

So Shimon is there right? Shu and Elira will collab with him and give them a free advertising to fujo audience huh?
If that happens I will become Elira and Shu's anti

>> No.28240613
File: 126 KB, 834x956, 666F5FB3-1B86-495F-B880-C8A7070CE3D8.jpg [View same] [iqdb] [saucenao] [google]
28240613

>>28240587
Riding him while I’m 8 months pregnant and leaking milk

>> No.28240623
File: 81 KB, 688x768, 109992015515.jpg [View same] [iqdb] [saucenao] [google]
28240623

>>28240482
Did you know Petra can play the recorder with her nose, and that she can play the guitar a bit too?

>>28240493
Keep piling up the charges buddy. You must really want that prison rape action.

>> No.28240626
File: 1.53 MB, 1442x2048, 1644778264215.png [View same] [iqdb] [saucenao] [google]
28240626

https://twitter.com/toto_nizi/status/1547911873693372417
more shu fanart

>> No.28240633

>>28240587
her pissing on my face through her tights

>> No.28240635

>>28240593
Anybody who replies to this post after me sucks nigger dicks

>> No.28240638

>>28240217
>>28240393
The announcement tweet has a similar amount of likes as the Obsydia merch announcement and they both don't even show anything but a date

>> No.28240645

>>28240499
I hope that one day fuuchan will write a light novel and sell it.

>> No.28240648

>>28240592
I have a feeling we'd get an official translation first then a fan one...
its not exactly complicated, but it depends on natchume if she wants it translated
go bug her in superchat or something later on when she shills vol2 in a later stream

>> No.28240652

>>28240527
I was talking about Elira.

>> No.28240653

>>28240610
If they are a flop and Stars management allows it, they'll collab 100%

>> No.28240664
File: 1.86 MB, 1442x2048, 1640484618472.png [View same] [iqdb] [saucenao] [google]
28240664

>>28240626

>> No.28240666
File: 861 KB, 1280x922, 1630635267539.gif [View same] [iqdb] [saucenao] [google]
28240666

pikapikapikapikapikachu

>> No.28240668
File: 316 KB, 1920x1080, 1657887744644.jpg [View same] [iqdb] [saucenao] [google]
28240668

!!!!!!!!

>> No.28240673
File: 243 KB, 391x355, 1657801750728.png [View same] [iqdb] [saucenao] [google]
28240673

>>28240593
So this is what NijisanjiEN is filled with lmao

>> No.28240675

>>28240623
yeah of course i know that

>> No.28240678

>>28240348
that depends on who you watched

>> No.28240684

>>28240668
Imagine the smell

>> No.28240686

>>28240673
me when I samefag

>> No.28240719

>>28240477
... i believe...

>> No.28240724

>>28240673
shut up Childe

>> No.28240743
File: 211 KB, 714x825, 1442344301.png [View same] [iqdb] [saucenao] [google]
28240743

>>28240675
Good you are now a Pentomo

>> No.28240745

>homostarsen
>new nijijp wave
En boys will lose a lot of asian fans

>> No.28240764

>>28240610
chimon
randon
aruvn
hanbyeol

there's your starsEN gen1

>> No.28240773
File: 23 KB, 314x314, 1646790843798.jpg [View same] [iqdb] [saucenao] [google]
28240773

>>28240743
wtf

>> No.28240788

>>28240745
Holostars are literal whos in Japan and China doesn't like Hololive. So no.

>> No.28240802

THE CHAIR
GIVE HIM THE CHAIR

>> No.28240808

>Mashiro and Naraka

>> No.28240810

>>28240333
One of them will be pure BFE, unlike Vox and his rape kinks for 14 year olds

>> No.28240829

>>28240764
Moe.....

>> No.28240842

>>28240810
based vox??

>> No.28240845

THE COMFYDANTS ARE RAPING NATSUME

>> No.28240853

>>28240788
>said increasingly nervous woman

>> No.28240858

>>28240425
In what way? Because you said he is? Or you keep reading over and over that he is? Is he?

>> No.28240861

I was thinking out of Luxiem what do you think their grooming habits are?
Mysta is probably completely hairless besides his head and waxes his asshole for example.

>> No.28240863

>>28240764
Seems like randon is the only one who's remotely ok there.

>> No.28240875

>>28240810
>Rape kinks for 14 year olds
Women are retarded it's what they like

>> No.28240876

>>28240495
I do that with Sonny's vods.... I must have replayed through his whole channel several times now...

>> No.28240878

>>28240810
>his rape kinks for 14 year olds
I will now watch your ASMRtuber.

>> No.28240884

>>28240527
I should do it actually...

>> No.28240887
File: 755 KB, 890x653, 1657781162613.png [View same] [iqdb] [saucenao] [google]
28240887

we're looping again it's all so tiring

>> No.28240888

>>28240861
I thought you meant a different kind of grooming...

>> No.28240890

>>28240861
>WAXING YOUR ASSHOLE

>> No.28240902

>>28240638
not a fair comparison, obsydia's been around for a year vs literal whos.
maybe someone can find the first tweet/trailer for luxiem and compare their numbers with starsEN.

>> No.28240908
File: 72 KB, 867x732, F56B31A1-4E00-40DF-A2D5-0E3ADE096EE8.jpg [View same] [iqdb] [saucenao] [google]
28240908

>>28240810
Vox raping me and babytrapping me…

>> No.28240912

do we really need so many boys doomposting timeloop?

>> No.28240913

>>28240853
Well, you got the femoid part right, but truthfully I wish they stood a chance. Competition is a good thing. The odds are just against them.

>> No.28240921

i want to erp with a rosebud

>> No.28240925

>>28240861
mysta never takes care of himself but is vulnerable enough to be groomed to the point that he epilates all of his bodyhair to crossdress more convincingly

>> No.28240933

You can tell it's tourists because they think Vox is BFE.

>> No.28240939

>>28240575
I can't believe anons twisted the story after the last stream

>> No.28240943

>>28240861
>grooming habits
sonny's little sister anon...

>> No.28240963

>>28240764
Shu
Fuuchan
Ike
Uki
But holo.....

>> No.28240970

>>28240745
The reason nijiENmales become big in the first place was nijiJPmales were big, human is social creatures, they will gravitate toward the biggest circle

>> No.28240972
File: 322 KB, 798x784, 1650224261715.png [View same] [iqdb] [saucenao] [google]
28240972

>>28240773
There's no escaping the basement now, bitch!

>> No.28240976

>>28240587
Loving baby making sex

>> No.28240981

>>28240921
theres one in vrc right now

>> No.28240987

>>28240933
Vox is fce. Favourite concubine experience

>> No.28240993

>>28240939
It's numberfags that don't watch streams, of course they twisted it.

>> No.28241003

>>28240933
they wouldn't understand that he's my wife(male)

>> No.28241007

>>28240861
Mysta takes a bath every day and loves looking good but then he'll also wear the same clothes for 3 weeks without washing them because he doesn't leave the house. So his grooming habits could go either way, I feel. But he definitely shave when he crossdresses at the very least.

>> No.28241011
File: 155 KB, 2048x2048, babyshu1.jpg [View same] [iqdb] [saucenao] [google]
28241011

Baby Shu!

>> No.28241017

Is Millie going to stream later without the handcam?

>> No.28241019
File: 32 KB, 824x132, 1630965895706.jpg [View same] [iqdb] [saucenao] [google]
28241019

>>28240912

>> No.28241029

>>28240890
You don't wax your asshole?

>> No.28241034

>>28240933
Putting in my shift at the Vox ASME BFE watching factory

>> No.28241040

>>28240908
It wouldn't be baby trapping since I'd be fully willing but I wouldnt mind resisting a bit if he's like...

>> No.28241043

>>28240788
vox made a china mishap and his fans didn't care because he's hot
girls don't care about nationalism, they just want a hot white male to jill off to

>> No.28241044

>>28241011
He's growing up??

>> No.28241046

>>28240987
Favorite cultist experience*

>> No.28241047

>>28240943
Shes adopted its different

>> No.28241049

>>28240933
Vox is AFE(autistic friend experience)

>> No.28241077

>>28240912
I just wish they'd loop in their own threads about this shit instead of coming here for some reason.

>> No.28241087
File: 295 KB, 737x418, BeachPetra.png [View same] [iqdb] [saucenao] [google]
28241087

Rosemi-sama is very cute and I will be expanding my skincare routine.

>> No.28241088
File: 111 KB, 480x480, 1643402053864.png [View same] [iqdb] [saucenao] [google]
28241088

femanons why wont you date pomudachis why are we so undesirable to women please help me to understand?

>> No.28241103

>thumbnail card battle vs Chaika

>> No.28241104
File: 531 KB, 1740x2048, 1657888456766.jpg [View same] [iqdb] [saucenao] [google]
28241104

Vox is my house husband.

>> No.28241108

>>28241040
100% same. I want nothing more than to get knocked up by him, but imagine being babytrapped and forced into giving up your career by CEO Vox… Becoming his housewife instead…

>> No.28241112

>>28241043
Only his Taiwanese fans got buttblasted about that, not mainlanders. And everyone in China is a nationalist, they drill it into your heads in school. I remember one of the prominent Coco antis being a woman.

>> No.28241114

>>28241049
This kind of goes for Luxiem as a whole

>> No.28241116

>>28241088
lmfao, look at this nigga

>> No.28241124

>>28241088
stinkidachi

>> No.28241143
File: 206 KB, 515x470, 1654989213351.png [View same] [iqdb] [saucenao] [google]
28241143

>>28241088

>> No.28241153

>>28241088
I love pomudachis!

>> No.28241156

>>28241029
NO waxing it would be so painful???

>> No.28241157

>>28241088
pathetic

>> No.28241160

>>28241088
give up on femanons pomie, it's not worth it.

>> No.28241168

StarsEN just needs to cater to the bros(me) and they'll do fine.

>> No.28241173

>>28241034
Which one are you watching? I need to catch up on some that sounded good.

>> No.28241177
File: 125 KB, 512x512, eoC2Yvv3DMPp8wSN5Z2wAQ.png [View same] [iqdb] [saucenao] [google]
28241177

I require big boobies in muh face

>> No.28241178

>>28241114
Luca and Ike are not autistic

>> No.28241191
File: 642 KB, 1700x2000, 1633669038062.jpg [View same] [iqdb] [saucenao] [google]
28241191

I love Rosemi with all of my heart!

>> No.28241197

is yugo being a lolicon

>> No.28241204

>>28241044
No, it's just summer time.

>> No.28241211

>>28240528
Not because of numbers, he thought his other content wasn't up to par compared to his best content (ASMR)
>>28166010

>> No.28241212

>>28241178
>Ike
Uhhhh

>> No.28241214

>>28241108
I'm not good at whatever I do anyway, so what's the use of wasting money to pay me? I could just stay home and have him provide for my every single need, I wouldn't have to worry about anything but looking pretty...

>> No.28241220

>>28241088
I love pomudachis! as a friend

>> No.28241231

>>28241173
Butler was really good and didn't have horny shit in it.

>> No.28241236

how is yugo's gacha skills on his pulls

>> No.28241242

>>28241088
i don't date anons unless it's sonny

>> No.28241244

>>28241178
>Luca
Well…

>> No.28241248

>>28241088
I like Pomudachi when they're being cute and talking about Pomu's streams but I don't like them when they talk about how Pomu is the only non-NPC female in the whole world.

>> No.28241251

>>28241088
You're stinky.

>> No.28241257

Chaika is too op

>> No.28241266
File: 156 KB, 850x1202, 9209640576d496f3a4b528fd3f7d9a62.jpg [View same] [iqdb] [saucenao] [google]
28241266

>>28241177
The best I can do given circumstances

>> No.28241288
File: 117 KB, 1024x714, 1639167142029.jpg [View same] [iqdb] [saucenao] [google]
28241288

hey guys my shitbike still works!!!! i think the carb just got flooded but its back to normal now, i just need to fix the mirrors and wait for my shoulders to stop hurting then im gonna ride again!!

>> No.28241292

>left the thread open yesterday
>come back
>hundreds of deleted posts
/NijiEn/ is going back in time

>> No.28241294

>>28241197
He's streaming? Yuguys...

>> No.28241300

>>28241177
A famelira posted this

>> No.28241312

>>28241257
He still plays Inscyption to this day!

>> No.28241327

>>28241214
Giving him oral under the kitchen table before he leaves for work in the morning...

>> No.28241328
File: 47 KB, 500x500, C28E8823-4BBA-488F-8A9E-2A1A006F6452.jpg [View same] [iqdb] [saucenao] [google]
28241328

>>28241088
Pomie…

>> No.28241329

>thumbnail card batlle vs Kagami shachou

>> No.28241330
File: 659 KB, 2667x4000, 1638650833838.jpg [View same] [iqdb] [saucenao] [google]
28241330

>>28241160
But...I don't wish to die alone.

>> No.28241340

>>28241288
congrats! don't hurt yourself again dummy :(

>> No.28241348

>>28241088
That one and merman are on my list for sure. Excited for what Vampire is gonna be like.

>> No.28241358

Do we have any info on Selen and Enna baseball performance ?

>> No.28241364

This card battle is kino

>> No.28241373

>>28241348
I want angst, milord please...

>> No.28241381

>>28241288
pop a wheelie to check safety

>> No.28241397
File: 116 KB, 432x520, 1649939732690.jpg [View same] [iqdb] [saucenao] [google]
28241397

>>28241348
HUH?

>> No.28241410

Shachou's thumbnails are something

>> No.28241412

>>28241329
Kino

>> No.28241417

mysta bath ASMR stream when

>> No.28241420

>>28241214
>>28241327
Sucking his cock under the table while he’s on a work phone call… him looking down at you and smirking because you’re just so cute with your mouth full of cock…

>> No.28241424
File: 247 KB, 1000x1000, 1647566601431.gif [View same] [iqdb] [saucenao] [google]
28241424

>>28241340
ill be safe!
>>28241381
ill do a rad wheelie!

>> No.28241434
File: 244 KB, 1727x1605, FXlqw-fXwAA7zi8.jpg [View same] [iqdb] [saucenao] [google]
28241434

>>28241373
He said it was gonna be super angsty, I'm excited.

>> No.28241435

>>28241358
They'll be riding the bench the whole tourney sadly.

>> No.28241436

>>28241358
their coach hasn't started yet

>> No.28241450

>>28238918
Literally just hide the obvious bait posts. 4chan gives you the tools to do so. You are not obligated to engage in someone's else schizophrenia. I went through years of false-flagging, gore and cp posting for simply liking holostars.

>> No.28241453
File: 194 KB, 1600x1835, FUPw48-acAUEyZL.jpg [View same] [iqdb] [saucenao] [google]
28241453

Please tell me if Millie's going to stream in less than two hours.

>> No.28241466

>>28241294
when i tuned in he was being menhera about being called onii chan and asking chat to do it for him and now hes calling klee his imouto

>> No.28241475

Funny to think that all these women fantasizing about being dommed by Vox are probably older than him.

>> No.28241479

>>28241373
It's ok sister, he said the angst is coming.
>>28241348
Merman is more creative storytelling, Butler is just someone taking care of you

>> No.28241483

>>28241417
Mysta GFE stream when...

>> No.28241497

>>28241483
That's every stream

>> No.28241502

>>28241475
Not likely, I’m only 21

>> No.28241512
File: 139 KB, 512x512, 1629962616057.png [View same] [iqdb] [saucenao] [google]
28241512

>>28241475
Women love young boy tho

>> No.28241516

>>28241434
Immortality has so much angst ans hurt/comfort potential, I can't wait!

>> No.28241520

>>28241483
whenever he does another late stream, he always gets lonely and insecure in the evening

>> No.28241521

>>28241475
Younger guy domming me UUOOOHHH

>> No.28241560

>>28241248
Girls like you wouldn't understand about Pomu, there's no single other weeb girl in the world who loves Japan and anime, used to cosplay at cons and posted their nudes online when they were young and dumb. She's a unique existence.

>> No.28241563
File: 6 KB, 439x514, 1657857328793 (3).jpg [View same] [iqdb] [saucenao] [google]
28241563

>> No.28241575

Bros, when NijiEN will be no more later this year, are we all gonna move to /2434/ thread?

>> No.28241578

>>28241512
Didn't know you were awake elira

>> No.28241593

>>28241497
he’s being cute in every stream... especially in his zatsudan part of the stream... my cute menhera gf

>> No.28241601

>>28240861
Someone wrote about this already

>> No.28241609

>thumbnail card battle vs Yashiro

>> No.28241610

>>28241512
>young boys
h-how lewd ><

>> No.28241625

>>28241294
I'm still salty about the kyoudai thing. I'll watch him again next week.

>> No.28241633

>>28241560
>posted their nudes online when they were young and dumb
haha… I would never…

>> No.28241638

>>28241609
what stream is this

>> No.28241640

>>28241575
Nah I'm moving to wherever Pomu and Rosemi and Elira end up, don't care about Nijisanji.

>> No.28241641

Was Yashiro reading off of a script? kek

>> No.28241651

>>28241625
What bothers you about it?

>> No.28241655

>>28241638
natsume 3d

>> No.28241669

>>28241638
The ongoing 3D debut stream

>> No.28241672

>>28241560
>posted their nudes online when they were young and dumb
if only you knew...

>> No.28241673

>>28241638
https://www.youtube.com/watch?v=1uKKrPccLo0

>> No.28241675

salaryman has a good voice

>> No.28241683
File: 237 KB, 2048x2048, FUVsaPjaIAEmA0l.jpg [View same] [iqdb] [saucenao] [google]
28241683

>>28241479
I honestly don't have a specific preference for his asmrs, it's nice to see where he goes with them. Some are horny and some are comfy and I'm ok with that.

>> No.28241689
File: 260 KB, 759x670, _214535.jpg [View same] [iqdb] [saucenao] [google]
28241689

>> No.28241698

>>28241640
Same. I hope they go to Twitch. Growth/networking as an Indie on YT sucks.

>> No.28241699

>>28241633
post yours and ill trade the ones i took when i was 14 and fit im a male

>> No.28241702

>>28241640
I mean they all will be merged with the main branch as EN won't be feasible anymore.

>> No.28241705
File: 240 KB, 1536x2048, 838D7173-D63A-4E04-9B86-2FEA5AA4593F.jpg [View same] [iqdb] [saucenao] [google]
28241705

>>28241593
Mysta's zatsudans and SC readings are the best. Normalfags will never understand.

>> No.28241708

>>28241424
People were actually concerned for you yesterday anon, so do be careful.

>> No.28241713
File: 642 KB, 1129x635, 243827432348.png [View same] [iqdb] [saucenao] [google]
28241713

I'll never have a duel against her...

>> No.28241722
File: 465 KB, 520x605, 1648669010206.png [View same] [iqdb] [saucenao] [google]
28241722

>>28241689
sonny kimoi

>> No.28241730

>>28241672
>>28241633
wtf just how common this is?

>> No.28241734

>>28241655
>>28241669
thanks

>> No.28241737

Kagami shachou and Yashiro are built to be card game duel villains

>> No.28241751

>>28241699
I posted my tits and thighs in one of the Confess threads once.

>> No.28241759

>>28241689
keep him away from cunny, he's dangerous

>> No.28241770

If Pomu and Selen graduate and join other corpos or go indie, do you think they still will be friends ? I like their collabs

>> No.28241771

Isn't that a character from her LN? lol

>> No.28241777
File: 155 KB, 1591x1620, 1640125278997.jpg [View same] [iqdb] [saucenao] [google]
28241777

>>28241708
i know, it was extremely heartwarming and i didnt know how to respond properly

>> No.28241781

Yashiro's dumb face always cracks me up

>> No.28241783
File: 38 KB, 662x611, FTR23JPaAAEBB-R.jpg [View same] [iqdb] [saucenao] [google]
28241783

>>28241689
rapist

>> No.28241790

>>28241730
For extremely dumb girls who were raised by parents who don't care, very

>> No.28241792

>>28241699
You'd go to jail just to satisfy a fempedo? That's admirable.

>> No.28241820

>>28241689
Elira....

>> No.28241821

>>28241770
Blood sisters will never die. They're really close, doubt they'll ignore each other if they do leave NijiEN.

>> No.28241825

>>28241737
>old men are dangerous
duh

>> No.28241834

>thumbnail card battle vs Chaika part 2

>> No.28241837

>tutorial guy is the final boss
Kino

>> No.28241842

Bros, why Holos copied Niji's idea of giving an idiotic names to their waves/gens?

>> No.28241870

I wanna play this card game
Probably better than yugioh

>> No.28241871

Wave 6/Tempus please give us a chaika chuuba...

>> No.28241881

>>28241651
I just liked the term and them calling each other kyoudai. I respect and understand Yugo's wishes and I agree (particularly with the mommy/daddy thing) that it needed to stop. I just didn't think the kyoudai thing had to go too. I know that it's just for him, and that fanworks or the others can still use it etc, but it just left me salty. It's just a little pet peeve I guess, and I'll watch and support him. Also doesn't help he's streaming Genshin which I hate.

>> No.28241900

>>28241870
Kuzuha thumbnail card deck...

>> No.28241905

>>28241871
Vox is chaika EN

>> No.28241923
File: 331 KB, 1129x629, 5943854385.png [View same] [iqdb] [saucenao] [google]
28241923

>> No.28241930

HEART OF THE THUMBNAILS

>> No.28241931

>>28241923
i can't read

>> No.28241941

>>28241900
Consistency makes for a good deck

>> No.28241955

>>28241842
they didn't, giving shit retarded names is just japanese culture

>> No.28241968

>>28241842
only for their male gens
the female gens still use the h*l* prefix

>> No.28241985

>using the current stream's thumbnail as the finisher
pottery

>> No.28241988

I want wave 6 to be chef themed where all the livers do cooking streams frequently and every month do a cooking versus collab. Basically just vtuber iron chef.

>> No.28241991

>>28241900
Depends on how strong his one thumbnail is.

>> No.28241996

>>28241931
Same, Millie

>> No.28242007

WIN EACH OTHER

>> No.28242011

Who are (You) watching right now ?

>> No.28242028

>>28241988
kino stream idea noted

>> No.28242034

>WIN EACH OTHER
KINOOOOOOOOOO

>> No.28242048

>>28242011
ewiwa's RE2 vod

>> No.28242050

>>28242011
watching pomu vods of course

>> No.28242055

>>28242011
Seffyna and Natsume

>> No.28242059

>>28241931
>cute laughing voice
>ganbatte
>natsume is good at drawing
>nicely energetic!
>good voice
>nijisanji (proper)

>> No.28242071

>>28242011
natsume and ichigo

>> No.28242072

RIKU?!

>> No.28242077

>>28242011
Seffyna

>> No.28242087

Is that Tazumi's voice?

>> No.28242088

Rikkun!?

>> No.28242090

>>28242011
tf2 sonny vod

>> No.28242098

Voice of god

>> No.28242101

>>28241988
Hello is there some nijistaff lurking here? Quick take a note and make it a new NijiProgram

>> No.28242107

I thought she was going to have a thumbnail card battle vs Riku Tazumi

>> No.28242113
File: 3.37 MB, 360x360, FA845FA6-46BD-4605-B9B8-431D457DFC66.gif [View same] [iqdb] [saucenao] [google]
28242113

>>28241988
Dagoth Ur for wave 6

>> No.28242122

Natsume just met god

>> No.28242136
File: 463 KB, 573x478, file.png [View same] [iqdb] [saucenao] [google]
28242136

reminder Reimoo's cover is premiering in 4 minutes. do yourself a favor and check out one of the best singers in NijiEn. for you schizos. I said one of, not that she's the best.
https://www.youtube.com/watch?v=qFzujolpZ8c
https://www.youtube.com/watch?v=qFzujolpZ8c
https://www.youtube.com/watch?v=qFzujolpZ8c

>> No.28242138

https://www.youtube.com/watch?v=qFzujolpZ8c
Reimu's cover premiere

>> No.28242161

>>28242011
Paprika

>> No.28242162

>>28242136
>>28242138
now kiss

>> No.28242164

>>28242090
still crazy that you can say that and it's not doxfaggotry

>> No.28242180

who's the other her?

>> No.28242188

>>28242164
the timeline we are in is surreal

>> No.28242194
File: 265 KB, 2048x2036, FW1da3JUIAAOoyY.jpg [View same] [iqdb] [saucenao] [google]
28242194

>>28242136
Good luck Reimu.

>> No.28242201

>>28242180
Mashiro

>> No.28242221

solo turing love....
nachume...

>> No.28242227

>>28242164
It was really cute, you could tell he loves the game. I hope his plans of more tf2 collabs come through, or even the mengen.

>> No.28242228

>>28242136
>best singers
It's over ghostling, I'm Reimu anti now

>> No.28242232

waymoo

>> No.28242249

>>28242188
imagine if he makes a compilation of all his kills in that stream

>> No.28242255

>>28242164
His vod comments are bad.

>> No.28242277
File: 1.00 MB, 1080x1527, 1648715841761.jpg [View same] [iqdb] [saucenao] [google]
28242277

>>28241248
>>28241560
I don't think pomudachis are interested in Pomu for what she was 15 years ago. We like Pomu because she grew into a good person and didn't just fall into drugs and depression or get babytrapped by some ugly fat loser like the other burnt out cosplay thots from that era.

But most importantly she doesn't look at her fans and fellow weebs with contempt the way most of those "weeb girls" do. She's genuinely enthusiastic when it comes to talking about anime and manga and her experiences in Japan. She doesn't automatically judge someone as a creep just because they like a certain anime or enjoy masturbating to JAVs. Trying to befriend women in the western anime fandom is like navigating through a minefield of traps just so you don't offend them because they all have extremely specific views of what weeb content is "acceptable to like" and feel very strongly about it.

I don't know why women get so offended that Pomudachis see Pomu as unique. If her personality is really that common then why have seemingly all of us never encountered someone like her before? Makes no sense. I think what's more likely is a lot of women just don't understand how hurtful it is to have your hobbies belittled constantly even by those who pretend to be your comrades. Pomu makes so many men feel at home just by watching her streams and listening to her ramble on about her hobbies. The sincere joy she shows when having a conversation with her chat about obscure 00's anime or dumb adventures in Japan or even visiting soaplands is really fucking cute and endearing.

If you can find me another woman like Pomu I'd gladly give her a chance, I'm not a misogynist, but I just don't want to be hurt by someone that will treat me like shit for daring to like Saya no Uta or some shit.

>> No.28242290

mysta playing mysta simulator
https://www.youtube.com/watch?v=akx6w9zlQBI

>> No.28242291

>>28242255
not as bad as Shu.
every comment and sentence has emotes.

>> No.28242314
File: 185 KB, 1013x1031, FXtSUniaMAAq1M9.jpg [View same] [iqdb] [saucenao] [google]
28242314

artists are fast

>> No.28242315

>>28242136
>>28242138
starting

>> No.28242329

fucking premiere countdown music scared me jesus christ

>> No.28242339

I want to thank Selen for organizing a lot of world collabs, without them Miya and nagao doign stuff with en and this tf2 collab would probably never happen

>> No.28242341

>>28242136
STARTING!

>> No.28242343

>>28242277
Yeah, this is why Pomudachi aren't getting any boob pics.

>> No.28242344

>>28242277
coggers

>> No.28242348
File: 91 KB, 1004x316, IMG_20220420_153522.jpg [View same] [iqdb] [saucenao] [google]
28242348

>>28242277

>> No.28242349

why is the premier music scary wtf

>> No.28242355

BUY NACHUME'SBOOK

>> No.28242361

Manga adaptation holy shit

>> No.28242365

The LN MC looks so generic

>> No.28242368

what on earth are these premiere trailers

>> No.28242370

My wife (male) is starting his second stream today!
https://www.youtube.com/watch?v=akx6w9zlQBI

>> No.28242374

https://www.youtube.com/watch?v=qFzujolpZ8c

PLEASE WATCH MILLIE'S FRIEND REIMU'S FIRST COVER SHE WORKED VERY HARD ON IT AND MILLIE WOULD REALLY APPRECIATE IT IF YOU'D GIVE IT A WATCH THANK YOU

>> No.28242381

i hate honeyworks but i hope this is good

>> No.28242385
File: 172 KB, 1111x1181, 1654521883450.jpg [View same] [iqdb] [saucenao] [google]
28242385

GOD WHY DOESN"T REIMU DO MORE KARAOKE
SHES SO GOOD AT SINGING

>> No.28242392
File: 41 KB, 200x200, 1642847232717.png [View same] [iqdb] [saucenao] [google]
28242392

>>28242277

>> No.28242401

>>28242011
Too depressed to watch anything. Aruvn most likely going to sharts while wave 6 most likely to get 5 more boring and untalented fujobaits.

>> No.28242407

she sounds so cute

>> No.28242408

almost doesn't sound like her

>> No.28242419

SHES SO CUUUUUUUUTE

>> No.28242430

Reimu-chan CUTE

>> No.28242437

It's her, I can still hear her SPICY LATINA vocals through the weeb lyrics.

>> No.28242439
File: 468 KB, 1405x2730, FXj_3IOVsAAeT8b.jpg [View same] [iqdb] [saucenao] [google]
28242439

cute reimu i'll oshi you

>> No.28242440

>>28242361
Well, at least that has a better chance of being translated than the novel.

>> No.28242451

>>28242408
its
Reimu forma del Nippon

>> No.28242457

Hold on, I missed something
Is she making illustrations for a LN?

>> No.28242463

Holy shit Reimu's voice.....

>> No.28242465

She sounds like a marshmallow taste

>> No.28242470

Weimu extra cute everyday wtf

>> No.28242486

>>28242457
she wrote a LN
BUY HER BOOK

>> No.28242489

>>28242465
She does, you're right

>> No.28242493

Reimu's sounds like a native Japanese.
It's like I'm listening to an Anime opening.

>> No.28242495

>>28242457
Her published LN is getting a manga adaptation

>> No.28242502

maybe its time to oshi reimu...

>> No.28242503

>Do my best as an Idol
oh no no no

>> No.28242507

>>28242457
She's a published LN author and her LN is getting a manga adaptation.

>> No.28242518

extra cute extra spicy

>> No.28242519
File: 102 KB, 1940x1080, 9D61ABD2-F820-42CC-870E-7FDF4FB8A047.jpg [View same] [iqdb] [saucenao] [google]
28242519

>>28242277
>I think what's more likely is a lot of women just don't understand how hurtful it is to have your hobbies belittled constantly
Nigger, are we using the same board? Just posting a male can break a thread into a war. Getting called "fujoshart" is a daily occurrence. Hell it's not even isolated to this board.

>> No.28242521
File: 102 KB, 1044x1141, 1648562747729.jpg [View same] [iqdb] [saucenao] [google]
28242521

DARKNESS IMPRISONING ME
ALL THAT I SEE
ABSOLUTE HORROR
I CANNOT LIVE
I CANNOT DIE
TRAPPED IN MY SOUL

PLEASE GOD WAKE ME
GOD WAKE ME
YEAAAAAAAAAAAAAAAAAAAAAAA

>> No.28242524

>>28242457
she wrote the LN, its getting a manga

>> No.28242533
File: 13 KB, 612x91, 1637288447525.png [View same] [iqdb] [saucenao] [google]
28242533

dorky penguin

>> No.28242534

Ike mixing songs again

>> No.28242540

>>28242486
>>28242495
>>28242507
Oh, nice! Thanks anons.

>> No.28242542

bros, let me tell you she's extra spicy AND extra cute today.

>> No.28242554

REIMOOOOOOO I LOVE YOOOUUU

>> No.28242563

>>28242486
Is there a digital version at least? Don't want to get fucked in the ass by shipping.

>> No.28242564

rate the cover

>> No.28242566

cute

>> No.28242577

THAT WAS CUTE. RELEASE MORE COVER REIMUUUUU

>> No.28242581

this is actually a good cover nice. Too bad that it will never get the views it deserves

>> No.28242589

I wouldn't mind if Mysta delayed...

>> No.28242593

Don't care about the song but that was cute

>> No.28242595

I rate it 10/10 but I'm a weeb

>> No.28242614

>>28242277
>I think what's more likely is a lot of women just don't understand how hurtful it is to have your hobbies belittled constantly
Are we living in the same reality? Women's hobbies and media get belittled all the time.

>> No.28242617
File: 162 KB, 585x564, 1644161502925.png [View same] [iqdb] [saucenao] [google]
28242617

I ended up watching clips. I didn't know Shu was utterly oblivious to Pomu trying to kill him in Amongus.

>> No.28242620

The song sucks but the lyrics fit her to a tee, probably why she chose it.

>> No.28242621

>>28242581
If only she had a penis

>> No.28242622

>>28242564
cute/10

>> No.28242623

weimu kawae

>> No.28242628
File: 995 KB, 2048x2048, FW1ZN85acAEv_yv.jpg [View same] [iqdb] [saucenao] [google]
28242628

I really liked this cover. Reimu did an amazing job, Ike didn't ruin it and it all works. Thank you Reimu and Ike.

>> No.28242652

The Reimu art from her cover looks better than her actual model. She really needs a 2.0 upgrade

>> No.28242657

does anyone know if she sang this song in karaoke before?

>> No.28242659

I can't begin to understand why singing isn't the core of Reimu's content.

>> No.28242667

turing love cover when

>> No.28242690

>>28242659
Perfectionism.

>> No.28242694

>>28242255
Not really, could have been worse. No namedrops from what I've read. Most egregious would probably be the "He's back, bros" and "If you know you know" comment

>> No.28242695

>>28242564
cute latina ghost/10
i wish the volume of her voice was turned up just a tiny bit more in the mix, it felt like she got drowned in the bass in some parts. she sounds really good though

>> No.28242710

Cover was decent. Kind of wish she picked a harder song though.

>> No.28242713

>>28242314
I like it when artist portrait sonny's face as the rapist that he is.

>> No.28242714

>>28242667
turing love is so overdone already anon, let it go...

>> No.28242720

>>28242617
anon... that was months ago...

>> No.28242721
File: 60 KB, 439x440, 1641600305816.jpg [View same] [iqdb] [saucenao] [google]
28242721

unexpectedly super cute and sounds amazing. she should do more covers...

>> No.28242747

This marks the beginning of rei-domination

>> No.28242757
File: 214 KB, 1300x1300, Squee.jpg [View same] [iqdb] [saucenao] [google]
28242757

Good cover from reimu I enjoyed it very much. I wonder why she hasn't done more of it when it's clearly her strong suite

>> No.28242789

>>28242757
Cursed luck, she kept bumping into problems one after another

>> No.28242793
File: 256 KB, 674x769, 1633900595181.jpg [View same] [iqdb] [saucenao] [google]
28242793

>>28242721
She's got like 5~ already done, just stuck in permissions hell because management sees her as low priority

>> No.28242795

Holy kek is this game Mysta's playing

>> No.28242807
File: 81 KB, 500x500, 1651948304193.png [View same] [iqdb] [saucenao] [google]
28242807

>>28242714
I won't stop until I get that Sonny and Petra Turing Love cover

>> No.28242814

funny bunny woooo

>> No.28242830

>>28242720
Yeah, I only watched Pomu's point of view.

>> No.28242842

>>28242564
very very cute/10

>> No.28242844

>>28242793
I'm sorry, Reimu
Hope you get your permissions!

>> No.28242848
File: 27 KB, 347x347, 1634318759270.jpg [View same] [iqdb] [saucenao] [google]
28242848

>>28242314
didnt plan on watching that stream but i need context behind this fanart...

>> No.28242852

I really liked the cover, not a fan of the song but Reimu pulled it off really nicely as it was cute as fuck

>> No.28242863

reimu, I know you're /here/
good fucking job

>> No.28242877

Mysta can't ride a bike...

>> No.28242883

>>28242793
Reimu you deserve better, but at least you're not giving up.

>> No.28242887

>>28242314
i would rape alban in this image

>> No.28242889

>>28242814
Has anyone in EN sang a the pillows song?

>> No.28242897

>>28242617
My maidenless by choice, Shumaid, is a dense not by choice

>> No.28242924

https://twitter.com/ike_eveland/status/1547929096214065153
A scheduled tweet is still a tweet... I guess...

>> No.28242938

>>28242659
This >>28242690 but also perms fucked her over. Same with Ike.

>> No.28242950

>>28242848
Using a sonny avatar and not watching every sonny streams ? Pathetic.

>> No.28242962

>>28242852
yeah i usually hate cute songs but she did great. more covers please.

>> No.28242991
File: 184 KB, 311x363, 1653962842730.png [View same] [iqdb] [saucenao] [google]
28242991

>>28242343
>>28242344
>>28242348
>>28242392
fuck you guys

>>28242519
>>28242614
Sorry if I'm wrong about that. Don't know why girls can't see Pomu's charm though if you realize how precious it is to have someone acknowledge and appreciate your interests without judgement.

>> No.28242996

where can I find a millie parfait gf

>> No.28243006
File: 2.63 MB, 1920x1080, Screenshot_1.png [View same] [iqdb] [saucenao] [google]
28243006

I have no idea what I'm watching

>> No.28243035
File: 29 KB, 383x384, 1650531351299.jpg [View same] [iqdb] [saucenao] [google]
28243035

>>28242950
im sorry! ill do better and channel my inner neet next time...

>> No.28243043

>>28242277
Are you the same Pomudachi that was saying girls are all vapid NPCs because they aren't interested in dinosaurs, mecha and space when she was playing 5 dates?

>> No.28243054
File: 10 KB, 516x100, 1638881275699.png [View same] [iqdb] [saucenao] [google]
28243054

Reimu....
I like the cover, Ike's mixing is a bit too overproduced but her voice is really cute.

>> No.28243067

>>28242807
man I really want to hear it. Petra's cute high voice and Sonny's low voice and they could mix it up with Peter singing and Sonny going higher

>> No.28243072

I want someone to cover this song
https://m.youtube.com/watch?v=4vmuNoy0pCo

>> No.28243075

>>28243006
Every youtube video in 2014

>> No.28243078

>>28242996
easier to find a millie parfait bf

>> No.28243102

reimu's cover hit different with subs turned on.

>> No.28243128

wherr can i get a gf

>> No.28243130

>>28243006
Goat Simulator is unironically fun as fuck

>> No.28243131
File: 324 KB, 1754x1240, 3169ED6F-11E0-4DC5-89D3-74ADE9DEEC61.jpg [View same] [iqdb] [saucenao] [google]
28243131

>> No.28243149
File: 453 KB, 2048x2048, 05A70F72-16F7-45F9-8E73-DF487BEA7C5D.jpg [View same] [iqdb] [saucenao] [google]
28243149

>Search Finana
>Only 3 results
>2 are links to her twitter the third is a ritual post
What happened? Can I talk about Feesh?

>> No.28243156

>>28243128
not here pomudachi

>> No.28243165

>>28243149
did you do your homework first?

>> No.28243167

>>28242277
women here post about their weird rape incest animal crushing pregnancy fantasies, i think there's more than a few women who won't judge you for your weird shit

>> No.28243181

reimu's singing voice in japanese is cute

>> No.28243194

>>28243072
I heard that Mashiro did a cover for that song. You should check it out.

>> No.28243200
File: 640 KB, 2062x2751, 1657011006540.jpg [View same] [iqdb] [saucenao] [google]
28243200

>>28242996
>where can I find a millie parfait gf
The average filipina is literally Millie.
Just feed her ice cream and sit her down to watch anime after she comes back from work and you'll turn her into Millie in less than a year

>>28243078
so true

>> No.28243217
File: 59 KB, 282x141, 1630729744580.png [View same] [iqdb] [saucenao] [google]
28243217

>>28243149
Educate yourself and find out anon.

>> No.28243223

>>28242996
try flipland?

>> No.28243237

>>28243149
go ahead. there's just a lot of bait about her right now

>> No.28243238
File: 234 KB, 394x394, 1628035500522.png [View same] [iqdb] [saucenao] [google]
28243238

>>28243067
that and roki with yugo please

>> No.28243246

>>28242713
Speaking of Sonny looking like a rapist...Sonny molesting Alban!
https://poipiku.com/5220826/7122129.html

>> No.28243256
File: 88 KB, 474x473, 1656863266852.jpg [View same] [iqdb] [saucenao] [google]
28243256

>>28243149
Just talk about Finana dood.

>> No.28243263

>>28243200
Jesus Christ are those real?

>> No.28243281

>>28243200
Bro those milkers.

>> No.28243290
File: 369 KB, 890x890, 1643585324346.png [View same] [iqdb] [saucenao] [google]
28243290

>>28243200
>sex goddess on the right

>> No.28243294

>>28242924
H-how did you know it's a scheduled tweet? Also, fellow quilldren, we just got nijiscenario crumbs today... we can survive this... let the man slep...

>> No.28243303
File: 3.12 MB, 2067x3486, IMG_20220711_022525.jpg [View same] [iqdb] [saucenao] [google]
28243303

reimu's cover was so cute

>> No.28243309
File: 1.20 MB, 971x560, file.png [View same] [iqdb] [saucenao] [google]
28243309

damn it why couldn't it have been petra or selen?
we could have had Lazulight vs Obsydia
I really wish management didn't force them to interact with Uki, it's always Uki, why they have to always place him in collabs as the only male?
fucking dumb

>> No.28243313
File: 28 KB, 830x128, 1657343182951.png [View same] [iqdb] [saucenao] [google]
28243313

>>28243246
Why do they make things so difficult...

>> No.28243329

>>28243149
You can always talk about Finana! Whenever you see my ritual post know that a ryuguard is lurking

>> No.28243337

>>28243131
god these uniforms are so...

>> No.28243349
File: 1.54 MB, 370x400, 1653737654231.gif [View same] [iqdb] [saucenao] [google]
28243349

>>28243200
God fucking damn it, both these creatures deserve the ojisan correction.
UUOOOOHHH

>> No.28243362
File: 442 KB, 495x635, 1629875588817.png [View same] [iqdb] [saucenao] [google]
28243362

>>28243043
No but if a person isn't at least slightly interested in archaeology or technology or outer space something must be wrong with them I think. Like all human progress has been inspired by the desire to seek out the unknown and learn about it, it's fascinating.

>>28243167
You'd think so but that's what makes it so frustrating. You can have a long conversation with a woman about her weird degenerate hobbies because you just enjoy listening to her talk about animal crushing or rape fantasies or guro or whatever but the moment you ask her to watch Made in Abyss with you she freaks out and calls you a pedophile because only her weird interests are OK. I've experienced this so many times I don't bother trying to connect with girls anymore.

>> No.28243393

>>28243309
>>28243313
in women's mind, they like hanging out with non threatening and flirty males
which is why homos are like girl accessories some time

>> No.28243394

>>28243294
It's a promo tweet posted right on the dot, and he hasn't had any other activity since yesterday. He also wasn't there for Reimu's premiere, and if he was available he wouldn't have missed it.

>> No.28243415

>>28242628
Reimu didn't even pay Ike for his work except by SC

>> No.28243420

>>28243362
At least you've talked to girls. Last time I've talked with one was before the pandemic started

>> No.28243422
File: 416 KB, 1440x1440, 1657074797324.jpg [View same] [iqdb] [saucenao] [google]
28243422

>>28243263
>>28243281
>>28243290

>> No.28243429

>>28243035
You better be. Can't be too easy with the kinds of you

>> No.28243434

>>28243393
you fucking nigger i thought this reply would be the answer

>> No.28243471

>>28243149
you're always welcome to talk about your oshi anon, most ryuguards probably left for discord or are lurking.

>> No.28243494
File: 1.24 MB, 1500x1200, FXnsSPpVsAE_C9E.jpg [View same] [iqdb] [saucenao] [google]
28243494

>>28243415
Did you watch Ike's stream? He doesn't want any money from her.

>> No.28243501

>>28243313
it's 355yes

>> No.28243508
File: 382 KB, 833x199, Screenshot_1.png [View same] [iqdb] [saucenao] [google]
28243508

The game knows.

>> No.28243514
File: 272 KB, 689x2048, 7DA93EDE-EF28-483D-ABFB-EB189434EABB.jpg [View same] [iqdb] [saucenao] [google]
28243514

>> No.28243515
File: 64 KB, 650x702, 1627946410345.jpg [View same] [iqdb] [saucenao] [google]
28243515

>>28243422
BIG MOMMY MILKERS

>> No.28243522

>>28243362
You are the same pomudachi.

>> No.28243526

>>28243422
You can see her bra through the blouse, fuck

>> No.28243560
File: 338 KB, 1742x2048, 1626705322341.jpg [View same] [iqdb] [saucenao] [google]
28243560

>>28243072
i'm glad to hear this again, i should really archive all of the stuff i listen to. so many vtuber songs i liked have vanished due to terminated accounts or randomly privated videos

>> No.28243568

>>28243422
I prefer the chink at the back

>> No.28243574

>>28243501
Thank you! I'm too lazy to do math.

>> No.28243580
File: 208 KB, 765x2048, EA552E2E-F7FE-4004-9878-D62CAA15E50F.jpg [View same] [iqdb] [saucenao] [google]
28243580

>>28243514

>> No.28243588

>>28243422
Stitch work on the hat is garbage, but I respect the grind

>> No.28243608

>>28243149
I think Finana is cute! Besides my oshi, she's the only one i watch when she does supa reading or zatsudan, it's so cute and comfy. I like both her feesh and finance voice.

>> No.28243621

>>28243309
Maybe they just like collabing with Uki? He's inoffensive and gets along with everyone, just a generically good collab partner for large groups.

>>28243420
The last girl I talked to offline was easily 5+ years ago so I think you still have me beat. I avoid making eye contact with women in public these days.

>> No.28243643

>>28243588
if you think that's bad just wait until Pomu's Pomie plushy

>> No.28243657

mysta is wiggling his butt

>> No.28243665
File: 98 KB, 470x455, 1657789617488.jpg [View same] [iqdb] [saucenao] [google]
28243665

Just made fudge brownies and they turned out really good

>> No.28243676
File: 481 KB, 645x686, 1650634234295.png [View same] [iqdb] [saucenao] [google]
28243676

>>28243501
what the fuck i got 373... great art though, very nice

>> No.28243678

>>28243514
NO

>> No.28243686

>>28243665
>malewife aloupeep

>> No.28243688

>>28243422
the button is doing the best it can.
keirei.

>> No.28243696

>>28243362
Wait how do you know Pomu wouldn't be the same way? Streaming is mostly her talking about her odd interests. What makes you think she'd happily listen to you talking about your weird fetishes while those other girls with weird fetishes wouldn't?

>> No.28243697

>>28243621
>Maybe they just like collabing with Uki
they don't even interact that much on stream, uki is always in the background

>> No.28243698

>>28243665
thanks for keeping us posted, care to share?

>> No.28243716

>>28243665
Share?

>> No.28243723

>>28243494
You know even Pomu paid Petra for her work on the MV despite offering to do it for free. Seems shitty to do of Reimu

>> No.28243724

>>28243686
I just used first pic i have save on my pic, i'm that 3 years old duvet insert pomudachi/dragoon

>> No.28243729

>>28243580
>>28243514
wtf

>> No.28243745

how good did leos do?

>> No.28243754

>>28243724
disgusting

>> No.28243766
File: 1 KB, 125x86, 1657817026540s.jpg [View same] [iqdb] [saucenao] [google]
28243766

>>28243362
>No but if a person isn't at least slightly interested in archaeology or technology or outer space something must be wrong with them I think. Like all human progress has been inspired by the desire to seek out the unknown and learn about it, it's fascinating.

You clearly have something wrong with you because as a wise man once said "Different people like Different thing". I like history, for example.

>> No.28243780

>>28243434
You still didn't solved it ? Kek

>> No.28243785

>>28243309
nigga management doesn't care about anything. Petra collabs with JPfags all day that's on her. Selen already collabs with Pomu and Finana often.

>> No.28243803

>>28243621
token gay friend

>> No.28243806

>>28243723
OH NO NO WHAT DO I DO, SOMONE IS ATTEMPTING TO BAIT THROUGH SHITPOSTING AGAIN

>> No.28243814

>>28243745
he hates the fact that his players want to go to a good college instead of training for koushien

>> No.28243819

>>28243309
Selen will only accept a collab if it favors her inner numberfag.
Pomu and Petra are only allowed to collab once every four months.

>> No.28243858
File: 1.02 MB, 4096x2896, FW-n_RiX0AI2hCV.jpg [View same] [iqdb] [saucenao] [google]
28243858

>>28243329
>>28243149
Don't forget to consume fish 3 times per week for a healthy balanced diet.

>> No.28243867

Do you guys archive all your oshis vods? I'm in the process of doing it and holy shit... i need to buy a new external drive

>> No.28243868

>>28243806
It's shitty not to pay someone for the work they did especially if that person is a friend.

>> No.28243900

I'm too retarded to finish a full run of Integrated Strategy 2...

>> No.28243915

I'm looking at Mysta's ass.

>> No.28243923

>>28243867
save it in 360p

>> No.28243928

>>28243868
Honestly I kind of get it, if I did something like that for a friend I wouldn't want them to pay me

>> No.28243941

>>28243814
Fuckers don't need higher education when Oliver has a fucking G in contact, first time i see a G in anything

>> No.28243955

>>28243923
fuck no, whats the point then

>> No.28243971

>>28243858
I'm not into heavy metal.

>> No.28243980

>>28243955
the point is to archive your oshi's vod.

>> No.28243982

>>28243867
I'm not losing media I like anymore. A 4tb hard drive is $60 and AV1 can cut the size of VODs in half with no loss in quality.

>> No.28243983

>>28243806
>shitposting
Just stating facts >>17996642
Dunno why Reimu couldn't pay Ike for his work.

>> No.28243987

>>28243867
I archive all of milord's asmrs at least. I might expand that to my favorite streams later on.

>> No.28243992

i was so certain randon would be wave 6 but now people are thinking he’s in holotempus… I just want a 30-something uncletuber with a bara model in nijien…
well his clips are still up 2 days before the debut so maybe there’s still a chance

>> No.28244011

>>28243941
G is bad ... yes? I'm still trying to learn the rules!

>> No.28244019

>>28243716
>>28243698
Sorry my phone camera is shit, won't focus

>> No.28244025

>>28243819
>Pomu and Petra are only allowed to collab once every four months

KEK

>> No.28244037
File: 127 KB, 1281x720, FW11aC5agAAuuDj.jpg [View same] [iqdb] [saucenao] [google]
28244037

>> No.28244046
File: 209 KB, 866x944, 1638348874869.jpg [View same] [iqdb] [saucenao] [google]
28244046

>>28243696
The difference is Pomu doesn't exclusively talk about her interests. She picks out comments in chat to reply to and asks followup questions even if it's about stuff she has no idea about so she can learn new things. She gives off an air of being genuinely interested in learning about other people, which is rare.

Of course given what she's said about her experiences with idols we know this is just her way of bringing a smile to her viewers' faces and she's not actually very interested, but the fact she's so considerate of others to encourage them to talk about their passions already makes her worth all the love in the world. I just really admire her a lot for how she approaches streaming.

>> No.28244048 [SPOILER] 
File: 2.81 MB, 3024x4000, 1640929937751.png [View same] [iqdb] [saucenao] [google]
28244048

>>28243900
seriously bro level your scene, she's a cute autistic sloth who will carry you if you don't have scene then hahaha good luck newcutie

>> No.28244055
File: 463 KB, 910x1201, FXstHRuUYAAv4y-.jpg [View same] [iqdb] [saucenao] [google]
28244055

>> No.28244064

>>28243982
how long do those 4tb drives last? I fear the data will get corrupted with time.

>> No.28244075

>>28243941
>>28244011
G is bad. The highest stat is S

>> No.28244079

>>28243980
yes, but I also want to look at her in all her glory + whatever game/ food she's making

>> No.28244082
File: 165 KB, 884x224, It's Ogre.png [View same] [iqdb] [saucenao] [google]
28244082

......

>> No.28244090

>>28243415
she's gonna pay him personally during their trip iykwim...

>> No.28244094

>>28244055
So pretty...

>> No.28244106

>>28244082
MY SIDES

>> No.28244108

>>28243223
all the women are crazy here

>> No.28244111

>>28243723
>>28243868
reimu wanted to pay, ike didn't want it
so she had to resort to sending it through supas. end of story.

>> No.28244123

>>28243867
no... i dont get too attached to media i like... ive had no problem wiping the same drive ive had for 5 years over and over for more space

>> No.28244131

>>28243858
I eat tuna everyday

>> No.28244134

>>28244055
what did she do to enna...

>> No.28244150

>>28243867
i'm fucked in terms of storage, so i've stopped archiving everything besides the most important things to me. i'd love to go full datahoarder with a server rack full of drives so i can archive everything but it's just too much storage

>> No.28244155

>>28244111
dumb reimu, she should have went through streamlabs

>> No.28244167

>>28244111
They’re going to keep samefagging about this for hours, ignore them. Same reimu schizo(s) everytime reimu is mentioned

>> No.28244176

>>28243858
Fish is about half my protein

>> No.28244180

>>28244064
that's why real data hoarders build a NAS with a ZFS RAID that has scrubbing enabled, that way the system will periodically scan over the data and ensure the checksums still match and restore it otherwise.

>> No.28244188

i just heard reimu’s cover and HOLY MOLYYYYY she sounds so cute! so proud of her

>> No.28244204

>>28244176
sonny please

>> No.28244215

>>28244064
Years and years and years. The SMART checks it does on itself will let you know 95% of the time there's an issue before failing. Just don't buy the most dogshit cheap drive you can and you'll be fine. Reddit has buildapcsales as a link aggregator for sales, use that and look for storage. Unironically the only thing that site is good for

>> No.28244220
File: 78 KB, 341x360, 1656988435027.png [View same] [iqdb] [saucenao] [google]
28244220

>>28244055
i'm no dragoon, but i kinda understand the appeal

>> No.28244227

>>28244155
She did.

>> No.28244234

>>28244111
KEK supas. Couldn't even send it through streamlabs even though she encouraged her own paypigs to move to streamlabs. What a hypocrite
So it's more important to her to show off paying rather than actually compensate him properly

>> No.28244243

>>28244082
>From 3view to 0view
Damn bro

>> No.28244249

>>28244082
Reimu...

>> No.28244256

>>28243309
I don't think I've ever hated someone as much as I've come to hate Uki
Him being a creepy personalityless fag who sexually harassed the rest of the branch is bad enough
But he has also become the new Shu and has forced himself into girl only collabs he shouldn't be a part of whilst adding basically nothing to them besides killing teeter between the girls

>> No.28244260
File: 183 KB, 1245x2048, 3A9BB920-3914-4B07-9B03-34E59826BD96.jpg [View same] [iqdb] [saucenao] [google]
28244260

Casual outfit Pomu

>> No.28244268

>>28244111
she's money laundering...

>> No.28244303
File: 620 KB, 1315x2028, 4DC36F54-83EF-4850-8E35-AD8CDCCBDB66.jpg [View same] [iqdb] [saucenao] [google]
28244303

>>28244188
Cute latina, I’m going to need to watch this everyday together with my oshi’s cover now

>> No.28244310

>>28244111
>supas

>> No.28244316

>>28244260
Casual sex outfit Pomu

>> No.28244343

>>28243867
Would reuploading the VODs to Youtube privately be a good way to archive?

>> No.28244370

>>28244055
I don't really like that dress.

>> No.28244371

>>28244343
no

>> No.28244383
File: 184 KB, 1696x1690, 1642750924080.jpg [View same] [iqdb] [saucenao] [google]
28244383

>>28243971
you should be
https://www.youtube.com/watch?v=43sk-2zczTk

>> No.28244393

>>28244111
see, this is why you shouldn't reply to schizos...

>> No.28244419

>>28244234
She paid through streamlabs not supa

>> No.28244431

>>28244343
YouTube matches reuploads of existing videos even if you private them, also it'll reencode.

>> No.28244438

>>28243723
Pomu didn't paid Ike, he apparently does free mixing for everyone.

>> No.28244457

>>28244234
>hypocrite
nina is a hypocrite.
HYPOCRITE HATE! HATE!

>> No.28244458

.....

>> No.28244461

prepare for the flip cosplays tomorrow there's gonna be a local con

>> No.28244472

>>28244458
most sane post itt

>> No.28244484

>>28244461
i hope at least half of them are crossdressers

>> No.28244490

>>28244461
my penis is ready

>> No.28244511

>>28244343
Anything other than offline storage puts you at the whims of other people. You can download select vods and compress them with AV1 if you need them smaller. I got Vox's Stanley Parable vod from 4.5 GB to 1.4 GB with no noticeable quality loss using AV1 and a GUI frontend for ffmpeg

>> No.28244518

It's really weird but I think I miss Nina.....

>> No.28244520

>>28244484
nah

>> No.28244576

>>28244461
cosplay carnival?

>> No.28244577
File: 266 KB, 948x225, 1638638094226.png [View same] [iqdb] [saucenao] [google]
28244577

>>28244111
>>28244155
>>28244234
>>28244310
Reimu sent it via streamlabs, not superchats.
https://youtu.be/cLGgUwZYC24?t=1231

>> No.28244580

I like to think nina is graduated whenever I don't see or hear anything about her.
It makes my day so much better.

>> No.28244611

>>28244484
lmao you wouldn't like flip crossdressers

>> No.28244651

>>28244577
ah ok my bad, some anon said superchat so I assumed she sent it through youtube. I don't watch Ike so I wouldn't know how to verify this.

>> No.28244653

>>28244577
Do not reply to schizo

>> No.28244668
File: 2 KB, 559x43, 5893769973878493.png [View same] [iqdb] [saucenao] [google]
28244668

>>28244234
>>28244310
my bad. it was a streamlab dono.

>> No.28244675

>>28244518
i didn't even know she was gone...

>> No.28244679
File: 2.89 MB, 600x338, 132674643876431.gif [View same] [iqdb] [saucenao] [google]
28244679

>> No.28244706

>>28244518
16 minutes!

>> No.28244719

>>28244653
they're not schizos, they're regular dumbfucks trying to start shit and deserve to be nipped in the bud

>> No.28244735

>>28244679
seffy cute

>> No.28244741

>>28244577
>Sent it through streamlabs instead directly into his Paypal or whatever
What a bitch

>> No.28244746

>>28244576
Anime and Cosplay expo

>> No.28244754
File: 1.50 MB, 975x1435, 1657142669088.png [View same] [iqdb] [saucenao] [google]
28244754

Good Morning Pomu!

>> No.28244776

>>28244577
She had to do it on stream huh?

>> No.28244778
File: 316 KB, 413x468, 1633880914640.png [View same] [iqdb] [saucenao] [google]
28244778

If I can't marry Pomu then I'll kidnap a breedable aged female and forcefully inflict Pomufication upon her until she is Pomu.

>> No.28244785

>>28244741
I will strangle you

>> No.28244798

>>28244719
>they're regular dumbfucks trying to start shit
so schizos?

>> No.28244809

>>28244776
He really really really didn't want it.

>> No.28244819

>>28244719
Yeah, schizos.

>> No.28244842

>>28244798
Regular schizos yes. We have one or two for each livers

>> No.28244851

>>28244785
Come try it, beesh

>> No.28244856

>>28244819
you don't know schizos. that word has lost it's meaning.

>> No.28244869

>>28244809
wow, so she's forcing him to accept money he doesn't want? That's fucking awful. I hope she dies! Anyway back to watching Gawr Gura oh she's not live

>> No.28244884

>>28244741
>reading comprehension
dumbass

>> No.28244903

>>28244856
It’s schizo when anon call it schizo.

>> No.28244916

>>28244746
i wanna go... feels embarrassing to ask people to go out to a con though

>> No.28244918
File: 170 KB, 1200x675, 1652373163633.jpg [View same] [iqdb] [saucenao] [google]
28244918

Hi I wish you all a good Friday! Do your best and don't push yourself too hard!

And congratulations for making it through the week!
here's a kiss for good luck chu~

>> No.28244928

>>28244851
yeah I bet you don't have much of a neck, tubby

>> No.28244933

>>28244903
ok schizo

>> No.28244951

BLACK BARS BLACK BARS BLACK BARS EVERYWHERE I SEE BLACK BARS

>> No.28244954
File: 81 KB, 248x400, 1639978759064.jpg [View same] [iqdb] [saucenao] [google]
28244954

>>28242564
I'm not a fan of the song itself but it was a pretty cute cover, She has a very good "cute" voice even if it's not the kind of stuff I'd expect from her (I didn't follow her PL so apologies if she actually did this a lot back then)

>> No.28244958

>>28244916
theres probably a few flipanons that would go with you

>> No.28244959

Why is Atlus so shit with permissions I want a Niji to play Persona 5.

>> No.28244966

>>28244933
You too, schizo

>> No.28244990
File: 232 KB, 267x370, 1647136680910.png [View same] [iqdb] [saucenao] [google]
28244990

>>28244918
thanks, you too peep

>> No.28244994

Is there any other Nijisanji livers call Petra as Peto?

>> No.28245006

anons help: lasagna rolls, burger, tacos, fried chicken, or bacon eggs and rice?

>> No.28245012

>>28244959
does persona 5 have trannies?

>> No.28245027

>>28244928
What can I say, more for you to grab on.

>> No.28245036

>>28244959
Someone need to kill the oldfucks at the top

>> No.28245050

>>28244954
Oh yes she did. She covered a shit ton of honeyworks songs.

>> No.28245068

>>28245006
burger and chimken

>> No.28245078

>>28245012
trannies raped a side character

>> No.28245082

Reimu's cover was super adorable!
I'm not a huge fan of this kind of cutesy song, though, so I can't help but hope she sings something else in the future that allows her to show off her voice more.
I'll loop this fanmix meanwhile...
https://www.youtube.com/watch?v=QXsqPIoTeo4

If it took her 280 days to release her first cover, I still have hopes for my oshi :')

>> No.28245093
File: 287 KB, 1733x2048, 1657892986363.jpg [View same] [iqdb] [saucenao] [google]
28245093

>>28244918
thanks aloupeep have a nice weekend!

>> No.28245099

>>28244959
Dragon's crown collab never ever.. 13 Sentinels stream never ever...

>> No.28245101

>>28244954
>She has a very good "cute" voice even if it's not the kind of stuff I'd expect from her
You clearly don't follow her even now kek she loves to sing cutesy songs

>> No.28245129

Vtuber took over my anime addiction, i used to watch 5-6 hours of anime a day and now it's 10 hours of streams a day, same anyone ? Also this site took away my discord addiction

>> No.28245140

>>28245082
Shu will NEVER release a cover

>> No.28245146

>>28244037
Best fucking music duo.

>> No.28245158

>>28244959
Because fuck your leech Vtubers
Profit loss is still profit loss

>> No.28245171
File: 439 KB, 1448x2048, IMG_20220712_113505.jpg [View same] [iqdb] [saucenao] [google]
28245171

>>28244918
done doing wagie shit so i can actually chill for the whole day and play genshin and tarkov

have a good day everyone

>> No.28245175

>>28245006
froid chomken

>> No.28245176

>>28245140
At this rate, Vox might do a cover before Shu.

>> No.28245180

>>28245146
petra...

>> No.28245187

>>28245006
Didn't you ask that like a week ago ? Tacos

>> No.28245194

>>28245129
Yea all the time I spent watching anime since 2021 has been dedicated to vtubers. Slowly trying to balance it out the past few months. Helpful because I watch less trashy anime now.

>> No.28245216

>>28245140
And this is why I'm jumping ship to StarsEN

>> No.28245241

>>28245187
I eat takeaway everyday, sometimes though I can't decide

>> No.28245251

>>28245216
Please do

>> No.28245252
File: 253 KB, 2048x1152, FXbHKBEXwAEn6I1.jpg [View same] [iqdb] [saucenao] [google]
28245252

>>28245146
Really subjective and biased, but they are one of the best duos for me overall. I just love them.

>> No.28245260

>>28245194
Yeah i'm not even sure what i used to do before vtubers, i doubt i watched that many flesh streamers

>> No.28245263

>>28244055
Honestly
Selen really should get smaller breasts
Have massive tits just doesn't fit her

>> No.28245270

>>28245216
Does StarsEN have any cute blonde aussies? Just curious

>> No.28245277

>>28244958
i would rather be sad about not going to a con than meet up with someone /here/ desu

>> No.28245299

>>28245241
Anon, your wallet...

>> No.28245309

>>28245176
Bet. Mysta will release his before Shu's.

>> No.28245311

>>28245270
did they even announce the design?

>> No.28245327

>>28245299
8 figures a month

>> No.28245345

Reimu first cover is about an idol wanting more gachikoi? bruh

>> No.28245346

Mysta is going on a date with me!

>>
Delete posts
Password [?]Password used for file deletion.
Captcha
Action