/NijiEN/ Nijisanji EN General

File: 200 KB, 800x1128, FaetYsfVsAA3ZsZ.jpg [View same] [iqdb] [saucenao] [google]

/NijiEN/ Nijisanji EN General Anonymous Wed Aug 24 20:40:38 2022 No.31592791 [Reply] [Original]

Nijisanji EN Youtube channels:
https://www.youtube.com/channel/UC-JSeFfovhNsEhftt1WHMvg/channels

Twitter:
https://twitter.com/NIJISANJI_World
https://twitter.com/i/lists/1415262975435231235

Lazulight:
https://twitter.com/PomuRainpuff
https://twitter.com/EliraPendora
https://twitter.com/3W1W4 (alt)
https://twitter.com/FinanaRyugu
https://twitter.com/RyuguFinana (alt)

Obsydia:
https://twitter.com/Rosemi_Lovelock
https://twitter.com/Petra_Gurin
https://twitter.com/Selen_Tatsuki

Ethyria:
https://twitter.com/MillieParfait
https://twitter.com/EnnaAlouette
https://twitter.com/NinaKosaka
https://twitter.com/ReimuEndou

Luxiem:
https://twitter.com/Ike_Eveland
https://twitter.com/Mysta_Rias
https://twitter.com/Vox_Akuma
https://twitter.com/Luca_Kaneshiro
https://twitter.com/Shu_Yamino

Noctyx:
https://twitter.com/sonny_brisko
https://twitter.com/uki_violeta
https://twitter.com/alban_knox
https://twitter.com/fulgur_ovid
https://twitter.com/yugo_asuma

Iluna:
https://twitter.com/MariaMari0nette
https://twitter.com/KyoKanek0
https://twitter.com/AiaAmare
https://twitter.com/AsterArcadia
https://twitter.com/ScarleYonaguni
https://twitter.com/RenZott0

Teamup schedule for Nijisanji EN:
https://teamup.com/ks1mraas71v3fjf1c2
https://walfie.github.io/niji-en-pinned/
https://nijien.vercel.app/

To watch streams at the same time:
https://holodex.net/
https://pomuhub.com/
https://niji-mado.web.app/home
Open devtools (F12 key), go to console tab, input the following code, then refresh the page.
localStorage.setItem('rulePauseOther', 0);
You only need to do this once, or until your browser data is cleared.

NijiEN song playlist:
https://youtube.com/playlist?list=PLKN0vyOK8SHelderZX3Vb84zwoAWoTKwR
To loop indefinitely get a browser extension preventing Youtube autopause.

Nijisanji chat log:
https://niji.chats.ninja/#/comment

Aggie archive:
https://catbox.moe/c/hp31z6

Our Minecraft Server:
ninisani.moe

Our watchalong site:
watch.ninisani.moe

Reminder to ignore bait, shitposting, samefags, discordfags, numberfags, tribalfags and falseflaggers.

Previous thread: >>31586077

>>	Anonymous Wed Aug 24 20:41:42 2022 No.31592836 Selen can't stop talking about penis....

>>	Anonymous Wed Aug 24 20:41:48 2022 No.31592846 File: 128 KB, 1347x854, Faz4m-RWYAEjoNU.jpg [View same] [iqdb] [saucenao] [google] Ike love!

>>	Anonymous Wed Aug 24 20:41:48 2022 No.31592844 File: 340 KB, 1471x1524, Fa85I7FUsAcgCu7.jpg [View same] [iqdb] [saucenao] [google] god kyo with tied up hair is so much better

>>	Anonymous Wed Aug 24 20:41:50 2022 No.31592848 File: 290 KB, 1192x2048, FaroNflUEAAt7T3.jpg [View same] [iqdb] [saucenao] [google] Our precious lovely Rosemi-sama

>>	Anonymous Wed Aug 24 20:41:55 2022 No.31592856 File: 512 KB, 1024x732, MystaLove.jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Wed Aug 24 20:41:56 2022 No.31592859 File: 966 KB, 4032x3024, 1660871301876755.jpg [View same] [iqdb] [saucenao] [google] Elira love! She's so cute and loveable

>>	Anonymous Wed Aug 24 20:42:29 2022 No.31592894 >>31592848 Do not lewd Rosemi-sama

>>	Anonymous Wed Aug 24 20:42:34 2022 No.31592899 File: 15 KB, 385x76, 1639630134641.png [View same] [iqdb] [saucenao] [google] Today I will remind them

>>	Anonymous Wed Aug 24 20:42:34 2022 No.31592898 >Rosemi raided Selen unity!

>>	Anonymous Wed Aug 24 20:42:41 2022 No.31592906 Selen saw a penis. Let's go.

>>	Anonymous Wed Aug 24 20:42:51 2022 No.31592917 File: 899 KB, 1280x720, 1539124461588.png [View same] [iqdb] [saucenao] [google] I miss Rosemi-sama already

>>	Anonymous Wed Aug 24 20:42:53 2022 No.31592922 god damn there are some real hotties in Ike's nijiselfie

>>	Anonymous Wed Aug 24 20:42:57 2022 No.31592926 dragoon? ryguard? you look like this? https://twitter.com/napingX/status/1562533370159980553

Anonymous Wed Aug 24 20:43:28 2022 No.31592948

>>31592655
>ADHD zoomer who comes from twitch where the culture is being a massive leech until you make it
>Only shows up when the girls get big numbers
>Rather than watch and enjoy the stream he spams dogshit in chat to get attention
It's all starting to add up desu

>>	Anonymous Wed Aug 24 20:43:30 2022 No.31592953 File: 472 KB, 1524x2048, 1655637476290.jpg [View same] [iqdb] [saucenao] [google] <3

>>	Anonymous Wed Aug 24 20:43:39 2022 No.31592962 >>31592906 read this in fulgur's voice

>>	Anonymous Wed Aug 24 20:43:41 2022 No.31592963 >>31592742 Thanks, guess I know what I'm whacking off to tonight

>>	Anonymous Wed Aug 24 20:43:46 2022 No.31592965 >>31592926 >OceanLaw faggot

>>	Anonymous Wed Aug 24 20:43:47 2022 No.31592968 File: 688 KB, 1500x3198, FXmdSzQXkAA9Nrw.jpg [View same] [iqdb] [saucenao] [google] I LOVE POMU!!!!!!!!!!!!!!!

>>	Anonymous Wed Aug 24 20:44:07 2022 No.31592985 File: 86 KB, 922x1024, FZTmCtOXkAA3ivk.jpg [View same] [iqdb] [saucenao] [google] >>31592899 you can't post that DELETE IT

>>	Anonymous Wed Aug 24 20:45:02 2022 No.31593030 File: 360 KB, 1170x1877, 1661356978515695.jpg [View same] [iqdb] [saucenao] [google] I LOOOOOOOOOVE NIJISELFIE

>>	Anonymous Wed Aug 24 20:46:05 2022 No.31593076 File: 64 KB, 642x749, Fa7-jybakAAE4O2.jpg [View same] [iqdb] [saucenao] [google] >>31592899 And I love him. Mysta love!

>>	Anonymous Wed Aug 24 20:46:22 2022 No.31593078 File: 298 KB, 1592x2048, 1632295072702.jpg [View same] [iqdb] [saucenao] [google] FEESH LOVE! SLUT LOVE!

>>	Anonymous Wed Aug 24 20:46:32 2022 No.31593088 viet pomudachick... https://twitter.com/LiuH16/status/1562522653818523650

>>	Anonymous Wed Aug 24 20:46:32 2022 No.31593087 >>31592742 >mentally ill chinese sisters They're just like us fr fr

>>	Anonymous Wed Aug 24 20:47:13 2022 No.31593122 >>31593088 Aia.....

>>	Anonymous Wed Aug 24 20:47:21 2022 No.31593132 File: 194 KB, 2048x1152, 1661374021161.jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Wed Aug 24 20:47:39 2022 No.31593146 >>31592848 SSSSSSSSSSSS EEEEEEEEEEEE XXXXXXXXXXXXXXX

>>	Anonymous Wed Aug 24 20:47:51 2022 No.31593157 File: 2.15 MB, 454x454, 1640445165665.gif [View same] [iqdb] [saucenao] [google] sonny love

>>	Anonymous Wed Aug 24 20:48:00 2022 No.31593164 >>31593132 The personification of /vt/ Enna knows

>>	Anonymous Wed Aug 24 20:48:18 2022 No.31593182 >>31592776 I just tried it and got $23 for two plush which is 3200 yen so not much different to be honest.

>>	Anonymous Wed Aug 24 20:48:40 2022 No.31593200 >>31593030 she's right, it's all underage zoomers

>>	Anonymous Wed Aug 24 20:49:38 2022 No.31593240 >>31593088 >unlike Pomu Rainpuff who looks flawless in basically every angle If only she knew...

>>	Anonymous Wed Aug 24 20:50:08 2022 No.31593268 Selen's reflexes still work at least.

>>	Anonymous Wed Aug 24 20:50:24 2022 No.31593280 I want Vox to impregnate me and rub my pregnant belly!

>>	Anonymous Wed Aug 24 20:50:32 2022 No.31593289 >>31593088 viets look so white these days

>>	Anonymous Wed Aug 24 20:51:16 2022 No.31593320 >>31592742 There is A LOT of minor chinese girls doing this, people are also noticing that too https://twitter.com/lionovelist/status/1562446959008395264

>>	Anonymous Wed Aug 24 20:51:53 2022 No.31593346 >>31593320 Why are we looping this again You guys really like underage sisters huh

>>	Anonymous Wed Aug 24 20:52:10 2022 No.31593358 >>31593182 That's cheaper than what I paid for 3 finger puppets anon. I paid ¥4,180 for the finger puppets

>>	Anonymous Wed Aug 24 20:52:20 2022 No.31593363 https://twitter.com/miha_mana/status/1562439101004935169 Yaminions...

>>	Anonymous Wed Aug 24 20:52:29 2022 No.31593372 File: 934 KB, 1199x848, 1656335235948.png [View same] [iqdb] [saucenao] [google] >>31593240 But it's true anon, look at her

>>	Anonymous Wed Aug 24 20:52:40 2022 No.31593388 >average MystASS enjoyer https://twitter.com/riasverse/status/1562302980803534848

>>	Anonymous Wed Aug 24 20:52:50 2022 No.31593395 >>31593346 What?! No, people are just noticing this. It's not like that

>>	Anonymous Wed Aug 24 20:53:09 2022 No.31593408 >>31592953 I love Ike with knives!

>>	Anonymous Wed Aug 24 20:53:11 2022 No.31593409 File: 3.22 MB, 316x420, 1636378880998.gif [View same] [iqdb] [saucenao] [google] For me, it's chibi pomu.

>>	Anonymous Wed Aug 24 20:53:41 2022 No.31593430 >>31593320 >wren why is this name always tied to the most mentally ill asian women?

>>	Anonymous Wed Aug 24 20:53:43 2022 No.31593431 File: 303 KB, 543x488, 1660950972436686.png [View same] [iqdb] [saucenao] [google] >Selen streaming >"people" here would rather discuss the twitter selfies of asian minors What happened to /nijien/ lol

>>	Anonymous Wed Aug 24 20:53:50 2022 No.31593438 File: 31 KB, 446x714, 1661374423654.png [View same] [iqdb] [saucenao] [google] >>31593409

>>	Anonymous Wed Aug 24 20:54:32 2022 No.31593469 >>31593388 >israel

Anonymous Wed Aug 24 20:54:39 2022 No.31593475
File: 513 KB, 2352x2520, 1660669835773425.jpg [View same] [iqdb] [saucenao] [google]

I scrolled down a lot and only saw like 2 pomudachis and fameliras. I'm glad to know we're the least cancerous fanbases in this shit but, man, that hashtag is genuinely depressing, when the fuck did vtubing become normalfag minor central?

>>	Anonymous Wed Aug 24 20:54:41 2022 No.31593477 @31593431 where do you think you are? >picture nevermind, i take my (You) back

>>	Anonymous Wed Aug 24 20:55:15 2022 No.31593506 man you guys are getting weird it reminds me of that time the underaged asian girl put "nijien" in her youtube name and people deep dived her channel

>>	Anonymous Wed Aug 24 20:55:37 2022 No.31593523 >>31593475 like 2 years ago?

>>	Anonymous Wed Aug 24 20:56:03 2022 No.31593547 >>31593477 Ostensibly a place to discuss Nijisanji streams instead of trawling twitter for underage chinese feet

>>	Anonymous Wed Aug 24 20:56:04 2022 No.31593548 >>31593358 I didn't say it wasn't different I said it wasn't a huge difference. It's like what 5 or 6 dollars between them. Both are still really expensive.

>>	Anonymous Wed Aug 24 20:56:07 2022 No.31593551 >>31593506 Okay but the time when we had a bunch of people roleplaying as nijisanji members was funny as fuck.

>>	Anonymous Wed Aug 24 20:56:46 2022 No.31593576 >>31593547 maybe reddit is more your speed

>>	Anonymous Wed Aug 24 20:56:56 2022 No.31593587 >>31593388 wow he is literally me

>>	Anonymous Wed Aug 24 20:57:01 2022 No.31593589 >>31593551 it really was and they had like fucking names like naruto or sakura and shit

>>	Anonymous Wed Aug 24 20:57:21 2022 No.31593605 https://twitter.com/PomuRainpuff/status/1562495995891826688 >Me + my oshi #nijiselfie what a whore

>>	Anonymous Wed Aug 24 20:57:21 2022 No.31593606 File: 1.06 MB, 1920x1080, R.jpg [View same] [iqdb] [saucenao] [google] >>31593475 It truly is a mystery

>>	Anonymous Wed Aug 24 20:57:29 2022 No.31593613 >>31593548 That's a pretty big difference. 23 for 2 plushies is better than 30 for 3 finger puppets.

>>	Anonymous Wed Aug 24 20:57:39 2022 No.31593620 File: 46 KB, 275x337, 1647298319056.jpg [View same] [iqdb] [saucenao] [google] Just ignore the retards

>>	Anonymous Wed Aug 24 20:57:56 2022 No.31593629 >>31593605 >not mito ?

>>	Anonymous Wed Aug 24 20:58:06 2022 No.31593637 >>31593506 Don't worry, we'll get our own gura groomer thing going soon enough. god that whole this was just despicable

>>	Anonymous Wed Aug 24 20:58:39 2022 No.31593657 >>31593606 bro its been like this for a year or so before they debuted like those "vtubers" showing their real faces on a stupid ass hashtag

>>	Anonymous Wed Aug 24 20:58:44 2022 No.31593663 >>31593551 It's easy to find those rp accounts, they are weird

>>	Anonymous Wed Aug 24 20:58:46 2022 No.31593664 >>31593576 Kill yourself

>>	Anonymous Wed Aug 24 20:58:57 2022 No.31593676 >>31593475 It all started with a scatman cover.

>>	Anonymous Wed Aug 24 20:59:09 2022 No.31593687 >>31593475 >we're the least cancerous fanbases >endless discord drama

>>	Anonymous Wed Aug 24 20:59:45 2022 No.31593723 >>31593629 Pomu thinks you can have more than one oshi and it was more an excuse to post that edit with the apple

>>	Anonymous Wed Aug 24 21:00:29 2022 No.31593746 File: 2.43 MB, 3296x2618, 1636426837861.jpg [View same] [iqdb] [saucenao] [google] Joining Feesh's sex cult!

>>	Anonymous Wed Aug 24 21:00:38 2022 No.31593753 File: 391 KB, 1520x2048, 1661369916609167.jpg [View same] [iqdb] [saucenao] [google] cocksleeve material

>>	Anonymous Wed Aug 24 21:00:42 2022 No.31593758 >>31593613 If it was like $5 compared to $20 I'd say it was a big difference but $23 as compared to $29? You're getting ripped off either way like always with shipping anything from Japan.

>>	Anonymous Wed Aug 24 21:00:55 2022 No.31593768 >>31593589 >>31593663 It reminds me of something that I'd do as a little kid. Google translate a random word into Japanese and put (Nijisanji) behind it. There's something so innocent about it that it makes me laugh a lot.

Anonymous Wed Aug 24 21:02:45 2022 No.31593851

>>31593523
>>31593676
I think it was probably by the end of 2019 with the Miko saying nigga and Matsuri band aids clips. It's really frustrating seeing all these fucking k-pop fags invading what was a weeb semi niche hobby. Now you can't say you're a vtuber fan without people thinking you're a terminally online twitter kid.

>>	Anonymous Wed Aug 24 21:03:10 2022 No.31593874 >>31593768 When I was a kid and used facebook I remember there was a lot of anime groups with rp, it was full of groomers too and it was really cringe kek. My sister got her current boyfriend thanks to those groups

>>	Anonymous Wed Aug 24 21:03:17 2022 No.31593878 >>31593723 she's correct. You can have several oshis and only one kamioshi.

>>	Anonymous Wed Aug 24 21:03:21 2022 No.31593886 >>31593758 I mean yeah it's still expensive but plushies are larger than finger puppets, it makes sense that they cost a bit to ship across seas. It's pretty ass that they're charging $30 for 3 puppets that are probably 1/10th of the size of a plushie

>>	Anonymous Wed Aug 24 21:03:49 2022 No.31593915 >>31593768 >as a little kid >Nijisanji uhh anon?

>>	Anonymous Wed Aug 24 21:04:25 2022 No.31593945 >>31593878 I agree, that's why she is my oshi and mint my kamioshi

>>	Anonymous Wed Aug 24 21:05:06 2022 No.31593985 File: 329 KB, 1152x2048, 1644972497544.jpg [View same] [iqdb] [saucenao] [google] Yep.

>>	Anonymous Wed Aug 24 21:05:24 2022 No.31594003 File: 343 KB, 1203x2047, Fa899tWUIAEXFCl.jpg [View same] [iqdb] [saucenao] [google] Feesh cult waiting room: https://youtu.be/4TKrTcA-44M https://youtu.be/4TKrTcA-44M https://youtu.be/4TKrTcA-44M

>>	Anonymous Wed Aug 24 21:05:25 2022 No.31594004 File: 111 KB, 480x480, 1651683891306.png [View same] [iqdb] [saucenao] [google] >>31593945 Same.

>>	Anonymous Wed Aug 24 21:05:27 2022 No.31594008 File: 442 KB, 800x800, 1660663818377599.png [View same] [iqdb] [saucenao] [google] Famelira, the harry potter watchalong is gonna be fun

>>	Anonymous Wed Aug 24 21:06:16 2022 No.31594047 >>31593915 I'm just saying that I don't think the nijisanji rp accounts are older than 13 at best honestly. As a line 12 yo kid I had the name of a Naruto character on RuneScape cuz I thought it'd make me look cool. I'd imagine it's the same

>>	Anonymous Wed Aug 24 21:06:17 2022 No.31594049 >>31593985 NijiEN's second wave, Obsdyia...

>>	Anonymous Wed Aug 24 21:06:27 2022 No.31594062 >>31593768 underage anon....

>>	Anonymous Wed Aug 24 21:06:38 2022 No.31594068 >>31593985 obsoyia...

>>	Anonymous Wed Aug 24 21:06:57 2022 No.31594082 Oh man those dragoons sure were cancerous talking about streams and shit, I'm soooo glad we finally chased them out so we can talk about underage chinese girls in peace

>>	Anonymous Wed Aug 24 21:07:33 2022 No.31594106 >>31594082 >chased them out

>>	Anonymous Wed Aug 24 21:07:39 2022 No.31594111 >>31594082 agreed. They didn't talk about streams either.

>>	Anonymous Wed Aug 24 21:08:41 2022 No.31594150 File: 398 KB, 1768x1153, Fa8rD4TaMAEv9kl.jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Wed Aug 24 21:08:49 2022 No.31594159 >>31594106 I wish...

>>	Anonymous Wed Aug 24 21:08:54 2022 No.31594163 dead hours tzm needs to accelerate just for these hours before 6pm est

>>	Anonymous Wed Aug 24 21:09:08 2022 No.31594178 >>31593985 Obysdia bros...

>>	Anonymous Wed Aug 24 21:09:10 2022 No.31594180 File: 140 KB, 1080x1080, 1656877023931.jpg [View same] [iqdb] [saucenao] [google] >>31593408 Of course

>>	Anonymous Wed Aug 24 21:09:11 2022 No.31594181 >>31594082 yeah, and meta-posting dragoons are even worse! good thing there's none of those around

>>	Anonymous Wed Aug 24 21:09:34 2022 No.31594200 >>31594082 Tiktok and Twitter are full of underage girls. Go take your complaints there, dipshit.

>>	Anonymous Wed Aug 24 21:10:02 2022 No.31594223 it really speaks volumes about a fanbase when SEA hours are the most tolerable ones For some reason it seems burgers love pushing the limits on how stupid and mean people can get

>>	Anonymous Wed Aug 24 21:10:12 2022 No.31594232 File: 648 KB, 902x1153, png2.png [View same] [iqdb] [saucenao] [google] >>31594150

>>	Anonymous Wed Aug 24 21:11:10 2022 No.31594269 it really speaks volumes about a fanbase when SEA hours are the most tolerable ones For some reason it seems burgers love pushing the limits on how stupid and mean people can get

>>	Anonymous Wed Aug 24 21:11:25 2022 No.31594282 >>31594163 Selen is streaming, dipshit Honestly I think this thread just hates women

>>	Anonymous Wed Aug 24 21:11:30 2022 No.31594286 File: 504 KB, 742x1284, 100002043_p2.png [View same] [iqdb] [saucenao] [google] post onaholes

>>	Anonymous Wed Aug 24 21:11:40 2022 No.31594293 >>31594008 I can't wait for her to be unable to shut up and for her to sperg out about every single scene, it's gonna be fun as hell

Anonymous Wed Aug 24 21:11:46 2022 No.31594297

Commission anon, if you believe this guy's art is to your liking it seems like they have pixiv requests open and they're kinda cheap (full illust 10000 yen and sketches 3000 yen). They also draw a lot of Nijisanji
https://www.pixiv.net/en/users/73235143/illustrations

>>	Anonymous Wed Aug 24 21:12:07 2022 No.31594319 >>31594223 >burgers It's peak Euro hours right now. Burgers are still at work/school.

Anonymous Wed Aug 24 21:12:24 2022 No.31594328

I was just thinking it's really a weird thing to be a streamer. Like your talking to and impacting the lives of all these people in so many different places you know. There's some chinaman in some 2 their city watching you, a Frenchman eating a baguette, some venezuelan dude, probably some saudi guy, a burger, an aussie. It's wild to think about all those different people in their rooms and the different cultures that surround them being united by watching this one thing.

>>	Anonymous Wed Aug 24 21:12:36 2022 No.31594340 >>31594282 Selen is streaming ? i didn't know she was still active ? How come dragoons never post her streams then ? I thought they were only shitposting their oshi while she was in hiatus.

Anonymous Wed Aug 24 21:12:49 2022 No.31594353
File: 1.17 MB, 2920x4096, 1659417624500660.jpg [View same] [iqdb] [saucenao] [google]

I just want to say that I LOVE my sexy wife Petra Gurin! Outfit reveal tonight! Noot noot! She's probably not getting oppai as big as this though but she'll still be sexy.

>>	Anonymous Wed Aug 24 21:12:58 2022 No.31594362 >>31593985 Obonionsia...

>>	Anonymous Wed Aug 24 21:13:01 2022 No.31594363 >>31594297 I'll consider it but I'm not that into his Enna one honestly. Pixiv is so hard to find artists that are actually available for commissions....

>>	Anonymous Wed Aug 24 21:13:31 2022 No.31594381 File: 759 KB, 1689x2048, FW853ApaQAAgTrL.jpg [View same] [iqdb] [saucenao] [google] >>31594353 she's finally getting hands

>>	Anonymous Wed Aug 24 21:13:54 2022 No.31594400 Elira in her pre-chat

>>	Anonymous Wed Aug 24 21:15:03 2022 No.31594455 File: 261 KB, 2048x2048, 1655808841053.jpg [View same] [iqdb] [saucenao] [google] https://www.youtube.com/watch?v=SuEkU4s-hOw

>>	Anonymous Wed Aug 24 21:15:40 2022 No.31594477 >>31594328 >blogposting on page 1 dead dying thread...

>>	Anonymous Wed Aug 24 21:16:16 2022 No.31594503 >>31594477 Yeah it's over.

>>	Anonymous Wed Aug 24 21:16:22 2022 No.31594507 File: 3.59 MB, 640x640, 1651043151683.gif [View same] [iqdb] [saucenao] [google] Pomu is never OK...

>>	Anonymous Wed Aug 24 21:16:23 2022 No.31594509 File: 66 KB, 465x117, 1635969887614.jpg [View same] [iqdb] [saucenao] [google] >>31594282 residentsleeper

>>	Anonymous Wed Aug 24 21:16:26 2022 No.31594511 >>31594328 Enna stop posting here.

>>	Anonymous Wed Aug 24 21:16:44 2022 No.31594525 File: 494 KB, 640x640, 1660566653694732.png [View same] [iqdb] [saucenao] [google] >>31594477 It's been like this all day

>>	Anonymous Wed Aug 24 21:16:46 2022 No.31594527 >>31594328 I don't know if that is a good thing

>>	Anonymous Wed Aug 24 21:17:17 2022 No.31594545 File: 90 KB, 1280x720, MillieCOME.jpg [View same] [iqdb] [saucenao] [google] >>31594340 >how come hahahahhahah

>>	Anonymous Wed Aug 24 21:18:38 2022 No.31594604 File: 975 KB, 2576x3437, FZIEcUIaMAAKGxE.jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Wed Aug 24 21:18:40 2022 No.31594605 File: 96 KB, 231x230, 1638701445664.png [View same] [iqdb] [saucenao] [google] >>31593030 What's with the kids these days and putting as much info about yourself as possible online? When did it get like this?

>>	Anonymous Wed Aug 24 21:19:05 2022 No.31594627 >>31594605 I blame Tumblr

>>	Anonymous Wed Aug 24 21:19:27 2022 No.31594640 I hope Pomu decides to play some game tonight instead of the storytime, but plays it very wrong on purpose just to spite her audience.

>>	Anonymous Wed Aug 24 21:19:29 2022 No.31594642 >>31594605 facebook

>>	Anonymous Wed Aug 24 21:20:36 2022 No.31594695 File: 18 KB, 128x128, 1640025234445.gif [View same] [iqdb] [saucenao] [google] >>31594640 Joke's on her, that only makes me harder!

>>	Anonymous Wed Aug 24 21:20:38 2022 No.31594700 crossdressing sex with mysta rias and ike eveland

>>	Anonymous Wed Aug 24 21:20:44 2022 No.31594705 >>31594640 pomu, metal gear solid graphic novel watchalong when ?

>>	Anonymous Wed Aug 24 21:21:05 2022 No.31594721 >>31594640 pomu doing something to spite her audience would certainly be a unique experience

>>	Anonymous Wed Aug 24 21:21:12 2022 No.31594724 >>31594328 das crazy

>>	Anonymous Wed Aug 24 21:21:42 2022 No.31594745 this Selen voice is becoming very jarring after listening to it for 2 hours...

>>	Anonymous Wed Aug 24 21:21:45 2022 No.31594749 >>31594705 >POMU YOU ARE WATCHING THE MOVIE WRONG

>>	Anonymous Wed Aug 24 21:22:43 2022 No.31594793 stop whining Selen, you did this to yourself. I am here to see you pee yourself not whine like a bitch

>>	Anonymous Wed Aug 24 21:22:56 2022 No.31594803 >>31594749 WHY ISN'T THERE ANYTHING ON THE SCREEN WHAT VOICE CHANGER DO YOU USE CAN I SNIFF YOUR CUNT

>>	Anonymous Wed Aug 24 21:23:14 2022 No.31594818 >>31594749 calm down pomu

>>	Anonymous Wed Aug 24 21:23:19 2022 No.31594821 File: 457 KB, 2500x1200, rule[sound=files.catbox.moe%2Fshzo1s.mp3].jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Wed Aug 24 21:24:25 2022 No.31594871 >>31594803 Sorry that last one was me

>>	Anonymous Wed Aug 24 21:24:38 2022 No.31594882 >>31594328 It's weird to be a 4chan poster as well.

>>	Anonymous Wed Aug 24 21:24:55 2022 No.31594897 >>31594605 Everyone was taught Internet safety skills until corporations found out that they could make a killing selling your personal data, so now if you do basic safety you're a weirdo with something to hide

>>	Anonymous Wed Aug 24 21:26:08 2022 No.31594950 5ch is talking about Selen's stream more than this thread Why do you all hate her so much

>>	Anonymous Wed Aug 24 21:26:21 2022 No.31594963 File: 1.69 MB, 2492x2492, 1660919070829105.png [View same] [iqdb] [saucenao] [google] when I wakeup, this thread is the first thing I check

>>	Anonymous Wed Aug 24 21:26:33 2022 No.31594972 >>31594605 social media and its consequences have been a disaster for the human race

>>	Anonymous Wed Aug 24 21:26:40 2022 No.31594979 >>31594950 I just checked, didn't see a mention of it

>>	Anonymous Wed Aug 24 21:26:47 2022 No.31594985 >>31594950 Post screencaps

>>	Anonymous Wed Aug 24 21:26:47 2022 No.31594984 someone send Pomu the Boneworks MGS VR mod. She can't play it on stream but at least she would enjoy it offstream

>>	Anonymous Wed Aug 24 21:26:53 2022 No.31594988 >>31594950 dragoons all migrated to the split

>>	Anonymous Wed Aug 24 21:27:07 2022 No.31594997 >>31594963 This but unironically

>>	Anonymous Wed Aug 24 21:27:09 2022 No.31595000 File: 68 KB, 864x950, 1634602273905.jpg [View same] [iqdb] [saucenao] [google] I want to hug feesh

>>	Anonymous Wed Aug 24 21:27:29 2022 No.31595010 >>31594950 tell the dragoons to come back then, and i'm talking about the dragoons that actually like her, not the ones that like only her big numbers.

>>	Anonymous Wed Aug 24 21:27:39 2022 No.31595019 What do 5ch think about Iluna?

>>	Anonymous Wed Aug 24 21:27:50 2022 No.31595027 >>31594950 go to the dragoon split otherwise you're not actually looking for discussion, you're just crying like a bitch

>>	Anonymous Wed Aug 24 21:27:53 2022 No.31595029 >>31594984 She already knows about it, she commented on a tweet about it a week or so ago

>>	Anonymous Wed Aug 24 21:27:54 2022 No.31595032 >>31594882 Yeah probably I just thought something was really deep when it wasn't because of chemicals.

>>	Anonymous Wed Aug 24 21:28:02 2022 No.31595035 File: 3 KB, 849x26, adfsghsgd.png [View same] [iqdb] [saucenao] [google] >>31594985

>>	Anonymous Wed Aug 24 21:28:16 2022 No.31595049 >>31594963 what the fuck is pomu's mouth doing?

>>	Anonymous Wed Aug 24 21:28:43 2022 No.31595073 File: 15 KB, 517x193, asdvcfaegfvqwaegvwegwasevweavweg.png [View same] [iqdb] [saucenao] [google]

>>	Anonymous Wed Aug 24 21:28:50 2022 No.31595084 File: 562 KB, 794x668, Dance of Death [sound=files.catbox.moe%2Fjyq0d6.mp3].png [View same] [iqdb] [saucenao] [google]

>>	Anonymous Wed Aug 24 21:28:56 2022 No.31595089 >>31595035 It's not about the stream though

>>	Anonymous Wed Aug 24 21:29:09 2022 No.31595095 >>31595073 I

>>	Anonymous Wed Aug 24 21:29:09 2022 No.31595096 >>31595019 For the most part they don't, but I know their nickname for Aia is "moth-san" and they call Kyo the EN Kou sometimes

>>	Anonymous Wed Aug 24 21:29:22 2022 No.31595109 >>31595019 they're bullish but they love your mother more

>>	Anonymous Wed Aug 24 21:29:25 2022 No.31595110 File: 158 KB, 1000x1000, 1633813867217.jpg [View same] [iqdb] [saucenao] [google] Nina Love!

>>	Anonymous Wed Aug 24 21:30:21 2022 No.31595143 >>31595089 They're talking about how cute her scared voice is and unicorning over her

>>	Anonymous Wed Aug 24 21:30:48 2022 No.31595162 Anybody have an archive of an entire channel? How much space does it take?

>>	Anonymous Wed Aug 24 21:31:07 2022 No.31595175 >>31595143 I always think selen's cute voice sounds kind of creepy.

>>	Anonymous Wed Aug 24 21:31:23 2022 No.31595190 File: 800 KB, 785x824, FankQinUYAAEUyR.png [View same] [iqdb] [saucenao] [google]

>>	Anonymous Wed Aug 24 21:31:29 2022 No.31595193 >>31595019 There's some number doomposting once in a while and a couple blamed Scarle's dark skin for her lack of numbers

>>	Anonymous Wed Aug 24 21:31:56 2022 No.31595213 https://youtu.be/uNPH4pSYnqM Get in?

>>	Anonymous Wed Aug 24 21:31:59 2022 No.31595217 >>31595143 >how cute her scared voice is and unicorning over her Dangerously Based, the more Dragooslings the better

>>	Anonymous Wed Aug 24 21:32:03 2022 No.31595218 File: 33 KB, 156x116, Mrpottsdam.png [View same] [iqdb] [saucenao] [google] Did someone say MEAT !?

>>	Anonymous Wed Aug 24 21:32:10 2022 No.31595221 >>31595143 >no screencaps Because they aren't talking about the stream

>>	Anonymous Wed Aug 24 21:32:56 2022 No.31595253 >>31595213 Is someone in NijiEN joining today?

>>	Anonymous Wed Aug 24 21:33:19 2022 No.31595269 >>31595253 Reimu, Millie, Enna

>>	Anonymous Wed Aug 24 21:33:21 2022 No.31595272 Elira is live! https://www.youtube.com/watch?v=bQ8QU1vAz4c

>>	Anonymous Wed Aug 24 21:33:30 2022 No.31595282 https://www.youtube.com/watch?v=uNPH4pSYnqM Fuwa starting! https://www.youtube.com/watch?v=bQ8QU1vAz4c Ewiwa starting!

>>	Anonymous Wed Aug 24 21:33:32 2022 No.31595284 File: 633 KB, 1854x2885, Fa3KyOXWAAAkCBJ.jpg [View same] [iqdb] [saucenao] [google] I dreamed about scrolling through and posting in these threads last night, I fucking hate everything

>>	Anonymous Wed Aug 24 21:33:39 2022 No.31595289 File: 299 KB, 1536x2048, Maid Mint bikini.jpg [View same] [iqdb] [saucenao] [google] Pomu LOVE I love this fairy comedian!

>>	Anonymous Wed Aug 24 21:33:53 2022 No.31595300 File: 140 KB, 1236x2048, 1652564434511.jpg [View same] [iqdb] [saucenao] [google] >>31595218 Man, it would filter most of his audience so hard but I'd love to watch Mysta play this. It'd be kino 100%.

>>	Anonymous Wed Aug 24 21:33:53 2022 No.31595298 File: 61 KB, 900x900, 1658370180059813.jpg [View same] [iqdb] [saucenao] [google] I think she'll soon meet the good doctor ?

>>	Anonymous Wed Aug 24 21:34:31 2022 No.31595324 love! love!

>>	Anonymous Wed Aug 24 21:34:52 2022 No.31595343 File: 336 KB, 1600x2000, FaNtjwDaMAACsOJ.jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Wed Aug 24 21:35:18 2022 No.31595358 Ethryia (minus Nina) on Fuwa's radio exercise https://www.youtube.com/watch?v=uNPH4pSYnqM

>>	Anonymous Wed Aug 24 21:35:20 2022 No.31595359 >>31592791 Is another all girl collab and.........

Anonymous Wed Aug 24 21:35:27 2022 No.31595364
File: 234 KB, 561x800, 4087340963479346.jpg [View same] [iqdb] [saucenao] [google]

Being attracted to mysta's model is the least gay thing possible. It basically looks like a woman anyway with the eyes and hair.
So you aren't actually gay for wanting to breed it as long as you don't hear Mysta's voice.
Which it isn't even really Mysta's voice if you think about it.
Because there's no way that if Mysta was an anime character that would actually be mysta's voice.
So I'm not guy for wanting to breed the model. As long as you don't think about his smooth balls or his anus while you jack off, there's nothing gay about it.

It's that simple really.

>>	Anonymous Wed Aug 24 21:35:38 2022 No.31595371 >>31595343 I want an alban puppet..

>>	Anonymous Wed Aug 24 21:35:44 2022 No.31595375 File: 78 KB, 949x949, 0287935619062.jpg [View same] [iqdb] [saucenao] [google] >>31595272

>>	Anonymous Wed Aug 24 21:35:54 2022 No.31595387 File: 302 KB, 1600x2000, FaNtjwDacAYIkHU.jpg [View same] [iqdb] [saucenao] [google] >>31595343

>>	Anonymous Wed Aug 24 21:35:57 2022 No.31595390 >>31595364 >The Fable Based

>>	Anonymous Wed Aug 24 21:36:02 2022 No.31595395 >chat spamming CENSOR CENSOR CENSOR over and over again I hate this

>>	Anonymous Wed Aug 24 21:36:28 2022 No.31595411 >>31595371 Ok Mahimahi

>>	Anonymous Wed Aug 24 21:36:40 2022 No.31595422 File: 732 KB, 3321x4096, FXSzcJzagAMEkEF.jpg [View same] [iqdb] [saucenao] [google] >>31595000 Me too!

>>	Anonymous Wed Aug 24 21:36:53 2022 No.31595429 Some of the outlast monsters are kind of cute

>>	Anonymous Wed Aug 24 21:37:18 2022 No.31595443 File: 2.01 MB, 1920x1080, Screenshotter--YouTube-2022-2’19”.jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Wed Aug 24 21:37:35 2022 No.31595458 Elira's cough....

Anonymous Wed Aug 24 21:37:48 2022 No.31595470
File: 334 KB, 2000x2000, a true patriot.jpg [View same] [iqdb] [saucenao] [google]

>>31595029
Kinda off-topic but I'm happy she tweeted to Kojumbo, I remember we lost a bet against her to tweet at him (during the Metal Gear anniversary) but it seems like she doesn't need people pushing her to do it.

>>	Anonymous Wed Aug 24 21:38:59 2022 No.31595516 File: 463 KB, 2048x2048, 1661337284170769.jpg [View same] [iqdb] [saucenao] [google] >>31595371 did the half anniversary puppet get sold out?

Anonymous Wed Aug 24 21:39:01 2022 No.31595519
File: 99 KB, 1153x1071, 1632122575717.jpg [View same] [iqdb] [saucenao] [google]

>>31595364
Whatever you do, don't think about the time he admitted to getting hard looking at himself naked in public because the thought of getting walked in on turned him on.

>>	Anonymous Wed Aug 24 21:39:14 2022 No.31595530 this japanese calisthenics stream is going places, maybe

>>	Anonymous Wed Aug 24 21:39:33 2022 No.31595543 Is fuwa always like this? Feels like watching a handicapped person

>>	Anonymous Wed Aug 24 21:40:07 2022 No.31595564 >>31595364 https://www.youtube.com/watch?v=aqRn19aS5XY

>>	Anonymous Wed Aug 24 21:40:16 2022 No.31595569 >>31594605 they know there is nothing about them the corpos and the NSA don't already know, so why hide anything

>>	Anonymous Wed Aug 24 21:40:20 2022 No.31595573 Enna...

>>	Anonymous Wed Aug 24 21:41:16 2022 No.31595616 Why do girls like Sasuke

>>	Anonymous Wed Aug 24 21:41:47 2022 No.31595644 >>31595616 They like being abused

>>	Anonymous Wed Aug 24 21:42:07 2022 No.31595657 POSSIBLE SWERVE ELIRA LORD OF THE RINGS WATCHALONG ON FRIDAY INSTEAD

>>	Anonymous Wed Aug 24 21:42:10 2022 No.31595661 >>31595616 They haven't actually watched Naruto just AMVs

>>	Anonymous Wed Aug 24 21:42:22 2022 No.31595670 >>31595616 If evil why hot

>>	Anonymous Wed Aug 24 21:42:30 2022 No.31595675 >I like the Frog Guy >Millie's favourite character in Naruto >prag

>>	Anonymous Wed Aug 24 21:42:39 2022 No.31595685 Millie likes the prag guy

>>	Anonymous Wed Aug 24 21:43:08 2022 No.31595712 >Rosemi likes old stuff >Millie likes old men UUUUOOOOOOOOOOOHHHH

>>	Anonymous Wed Aug 24 21:43:25 2022 No.31595730 >>31595670 he not hot doe

>>	Anonymous Wed Aug 24 21:43:32 2022 No.31595738 File: 283 KB, 1518x2048, 1635122601748.jpg [View same] [iqdb] [saucenao] [google] >>31595364 Based. Though personally, I love his voice and would listen to his moans while having sex with him.

>>	Anonymous Wed Aug 24 21:43:35 2022 No.31595742 >>31595616 >Dark >Edgy >Brooding >"Cool" These types of characters are always the favorite regardless of gender or media

>>	Anonymous Wed Aug 24 21:44:02 2022 No.31595765 >>31595670 Scarle, get outta here

>>	Anonymous Wed Aug 24 21:44:37 2022 No.31595790 millie the type of girl to let mr roshi perv on her

>>	Anonymous Wed Aug 24 21:44:56 2022 No.31595809 >>31595670 based philosophy

>>	Anonymous Wed Aug 24 21:44:57 2022 No.31595810 >>31595162 I have every vod for someone who streams a lot and right now it's at like 900 gigabytes

>>	Anonymous Wed Aug 24 21:45:03 2022 No.31595813 File: 265 KB, 1502x2048, FZUC4gdaIAAt2mm.jpg [View same] [iqdb] [saucenao] [google] >>31595364 he's already insecure about his own voice you should make him feel all embarrassed and hold back on moaning while you fuck him doggy style

>>	Anonymous Wed Aug 24 21:45:08 2022 No.31595817 File: 354 KB, 457x457, 1644983256702.png [View same] [iqdb] [saucenao] [google] bros i'm pacing around the room and feeling cringe because fuwa minato is singling out enna's japanese because she only knows it from watching anime

>>	Anonymous Wed Aug 24 21:45:35 2022 No.31595838 POG

>>	Anonymous Wed Aug 24 21:45:44 2022 No.31595844 File: 500 KB, 1576x2682, 1639204094634.jpg [View same] [iqdb] [saucenao] [google] ToT

>>	Anonymous Wed Aug 24 21:46:09 2022 No.31595860 >>31595670 he isnt even evil he is just dumb. Like holy shit is he dumb. As dumb as Naruto honestly.

>>	Anonymous Wed Aug 24 21:46:21 2022 No.31595871 >Fuwa likes Millie's covers of Marshall Maximizer and Phony

>>	Anonymous Wed Aug 24 21:46:30 2022 No.31595878 >>31595616 school shooter aesthetic is currently "in" with zoomers.

>>	Anonymous Wed Aug 24 21:46:41 2022 No.31595886 >>31595543 to some extent yes, though it's multiplied by a thousand by him trying to speak in english

>>	Anonymous Wed Aug 24 21:47:10 2022 No.31595906 >>31595878 >zoomers >naruto

>>	Anonymous Wed Aug 24 21:47:28 2022 No.31595918 Extended LOTR public watchalong... LET'S FUCKING GOOOO

>>	Anonymous Wed Aug 24 21:47:42 2022 No.31595931 Millie...

>>	Anonymous Wed Aug 24 21:47:47 2022 No.31595938 File: 123 KB, 319x300, 1651622024661.png [View same] [iqdb] [saucenao] [google] I'm gonna post bait! Ahem! I think Rosemi is a dummy and Pomu is less stinkier than she is!!11!1

>>	Anonymous Wed Aug 24 21:47:54 2022 No.31595945 Elira is insane, she's gonna do a public watchalong marathon of all three LOTR extended editions, and is gonna watch the first Harry Potter movie (and squeal/talk the whole time) for her 12 hour members stream this week

Anonymous Wed Aug 24 21:47:56 2022 No.31595948

>>31594363
I'm sure you already know about this, but if you're like me, you've probably followed several hundreds of artists on pixiv over the years. The requests page now by default will show you who among your followed artists are currently accepting requests, so it's pretty easy to find someone taking a request with your tastes.
https://www.pixiv.net/request/creators/illust
Looking at it for myself, I even notice that a couple of the artists I follow straight up say in their request terms to DM them to discuss more details.

>>	Anonymous Wed Aug 24 21:47:57 2022 No.31595949 NOT THE CONDOM

>>	Anonymous Wed Aug 24 21:48:02 2022 No.31595952 >>31594328 >united Funny guy.

>>	Anonymous Wed Aug 24 21:48:03 2022 No.31595953 Change of plans Elira wants to plan a future stream where she wants to watch all 3 Lord of the Rings movies back to back to back, being a first time watcher Vox says he will be there She will post it in their discord for anyone to join

>>	Anonymous Wed Aug 24 21:48:21 2022 No.31595968 MILLIE NO!

>>	Anonymous Wed Aug 24 21:48:42 2022 No.31595983 File: 65 KB, 937x821, 1645601793869.jpg [View same] [iqdb] [saucenao] [google] Why is she like this.

>>	Anonymous Wed Aug 24 21:48:42 2022 No.31595984 >>31595860 >dumb No it was literal mental illness when the Uchiha experience a great loss their brains flood with chakara and thus their sharingan is unlocked

>>	Anonymous Wed Aug 24 21:48:45 2022 No.31595988 >>31595918 i'm guessing you're talking about elira ?

>>	Anonymous Wed Aug 24 21:49:05 2022 No.31596007 Enna is dying inside....

>>	Anonymous Wed Aug 24 21:49:07 2022 No.31596012 >>31595983 She needs a bonking

>>	Anonymous Wed Aug 24 21:49:40 2022 No.31596045 File: 96 KB, 213x292, rosemipillowsad.png [View same] [iqdb] [saucenao] [google] >>31595938 b-buds... p-please... I worked so hard on that bait... i'm gonna cry

>>	Anonymous Wed Aug 24 21:49:43 2022 No.31596048 File: 105 KB, 652x522, 1660686183415847.jpg [View same] [iqdb] [saucenao] [google] >>31595953 MY SHIP

>>	Anonymous Wed Aug 24 21:49:59 2022 No.31596060 >>31595988 Vox says he's in too

>>	Anonymous Wed Aug 24 21:50:14 2022 No.31596076 >>31595988 She decided to do Harry Potter watchalong during the members 12 hours stream and then LOTR extended edition public stream next saturday and anybody who wants to join can. Vox was already in chat and has already claimed a spot.

>>	Anonymous Wed Aug 24 21:50:17 2022 No.31596082 >>31595968 >>31595983 >>31596012 Condom? That was the only word I heard of her. But how did she use it in a sentence?

>>	Anonymous Wed Aug 24 21:50:19 2022 No.31596085 >>31595988 Yes, it's gonna be like a Totsu too, Vox alredy said he's gonna be there

>>	Anonymous Wed Aug 24 21:50:19 2022 No.31596088 File: 372 KB, 890x653, 1661262368225270.jpg [View same] [iqdb] [saucenao] [google] >>31595938 no...

>>	Anonymous Wed Aug 24 21:50:24 2022 No.31596093 >lotrposting wil be on topic At long last...

>>	Anonymous Wed Aug 24 21:51:00 2022 No.31596113 >>31596048 LET'S GOOOO Shu will 1000% be there too kek

>>	Anonymous Wed Aug 24 21:51:17 2022 No.31596126 >long Finana membersfeesh anniversary stream tomorrow >12 hour Elira membersheesh anniversary stream on Friday >then Elira LOTR marathon next week These lazugirls are gonna kill me...

>>	Anonymous Wed Aug 24 21:51:28 2022 No.31596138 File: 1.45 MB, 1345x1066, 1649499668009.png [View same] [iqdb] [saucenao] [google] >31595938 HAHAHAHA NICE BAIT BUD

>>	Anonymous Wed Aug 24 21:51:34 2022 No.31596145 >>31595284 Imagine Reimu getting a good model. A man can dream I guess.

>>	Anonymous Wed Aug 24 21:51:34 2022 No.31596146 Fuwa watches Enna?

>>	Anonymous Wed Aug 24 21:51:57 2022 No.31596162 File: 32 KB, 457x457, 1652912937875.jpg [View same] [iqdb] [saucenao] [google] HE WATCHES ENNA'S STREAM

>>	Anonymous Wed Aug 24 21:52:38 2022 No.31596193 >>31596146 enna use elementary level english, she's easy to listen to.

>>	Anonymous Wed Aug 24 21:52:44 2022 No.31596197 @31595938 You are no longer brother of mine bud

>>	Anonymous Wed Aug 24 21:52:58 2022 No.31596213 File: 122 KB, 395x384, 1654426579206.png [View same] [iqdb] [saucenao] [google] AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAH I MISS POMU

>>	Anonymous Wed Aug 24 21:53:10 2022 No.31596220 Elira's capture card just fuckin died

>>	Anonymous Wed Aug 24 21:53:46 2022 No.31596246 Earthbound just seems cursed...

>>	Anonymous Wed Aug 24 21:53:47 2022 No.31596249 Reimu died doing stretchings

>>	Anonymous Wed Aug 24 21:53:48 2022 No.31596250 Capture cards are such a fucking pain. If I had the money these girls did, I'd literally buy like three of the same kind so I could just swap them out as they run into issues.

>>	Anonymous Wed Aug 24 21:54:11 2022 No.31596277 None of them are fit.

>>	Anonymous Wed Aug 24 21:54:12 2022 No.31596278 File: 3.71 MB, 360x360, 1661148358706.gif [View same] [iqdb] [saucenao] [google] time for calisthenics and questionable bird noises

>>	Anonymous Wed Aug 24 21:54:13 2022 No.31596280 File: 744 KB, 169x206, 1660282208639.gif [View same] [iqdb] [saucenao] [google] What would sex with Pomu be like?

>>	Anonymous Wed Aug 24 21:54:18 2022 No.31596282 And Millie is orgasming for some reason

Anonymous Wed Aug 24 21:54:20 2022 No.31596286

>>31588069
>Fulgur feels cucked these days I bet. With Millie and Regis interactions ramping up, her collab with Ike the sexman coming up notnot tomention the 3 days she spent with him IRL.
He tries to bounce off to Enna even holding off yesterday's collab for her but she openly wants to date Sonny and she made a ship with Kyo on stream with him after flirting with him like a middle schooler all throught their collab.

Now he's left with Uki's megapozzed bussy...
Reminds me of these two anime:
1.) Grope - Yami no naka no Kotoritachi
2.) I Can

>>	Anonymous Wed Aug 24 21:54:43 2022 No.31596301 >nina the only one missing You can’t make this shit up

>>	Anonymous Wed Aug 24 21:54:56 2022 No.31596309 File: 217 KB, 455x455, pomu3.png [View same] [iqdb] [saucenao] [google] >>31596213 Someone made the first 4 maps of MGS1 in VR complete with sneaking, AI's and other shit Pomu should play it

>>	Anonymous Wed Aug 24 21:55:22 2022 No.31596327 >>31596301 She just got home just hours ago.

>>	Anonymous Wed Aug 24 21:56:10 2022 No.31596360 >>31596280 >That's it Pomu... go a little faster... >Shut the fuck up, if you tell me what to do then I won't do it, ok? just shut up

>>	Anonymous Wed Aug 24 21:56:22 2022 No.31596369 I did the dance!! I did it!!! Is millie fat?

>>	Anonymous Wed Aug 24 21:56:23 2022 No.31596371 >She sounds like she's giving birth Who was Enna talking about? Both Reimu and Millie are tired.

>>	Anonymous Wed Aug 24 21:56:38 2022 No.31596383 >>31596280 Anal only probably

>>	Anonymous Wed Aug 24 21:56:52 2022 No.31596398 >>31596277 only one fit vtuber comes to mind

>>	Anonymous Wed Aug 24 21:57:03 2022 No.31596407 >>31596280 No condom only raw.

>>	Anonymous Wed Aug 24 21:57:04 2022 No.31596408 Please great Rosemi-sama.....heal me with your magic powers

>>	Anonymous Wed Aug 24 21:57:10 2022 No.31596417 File: 153 KB, 512x512, 1631740335607.png [View same] [iqdb] [saucenao] [google] >Rosemi-sama didn't join >No morning exercises with Rosemi-sama Rosemi-sama...

>>	Anonymous Wed Aug 24 21:57:24 2022 No.31596426 >>31596301 fish...

>>	Anonymous Wed Aug 24 21:57:41 2022 No.31596436 Elira's Earthbound struggles You got this Ewiwa!

>>	Anonymous Wed Aug 24 21:57:55 2022 No.31596447 >>31596398 Who? The Pogman?

>>	Anonymous Wed Aug 24 21:58:09 2022 No.31596465 File: 17 KB, 505x546, 1657229909293190.jpg [View same] [iqdb] [saucenao] [google] Our goddess returns!!!! https://www.youtube.com/watch?v=UHQ8jY2oZlY https://www.youtube.com/watch?v=UHQ8jY2oZlY https://www.youtube.com/watch?v=UHQ8jY2oZlY

>>	Anonymous Wed Aug 24 21:58:40 2022 No.31596496 >>31596398 i can think of 2

>>	Anonymous Wed Aug 24 21:58:41 2022 No.31596497 File: 120 KB, 600x600, 1625914743009.gif [View same] [iqdb] [saucenao] [google] fuwa's exercise is ez compares to what I used to do in my pe class

>>	Anonymous Wed Aug 24 21:58:50 2022 No.31596506 >Aia

>>	Anonymous Wed Aug 24 21:58:50 2022 No.31596507 >>31596465 >Open link >No Rosemi-sama Why would you lie to me?

>>	Anonymous Wed Aug 24 21:59:07 2022 No.31596519 >>31596398 yeah, me.

>>	Anonymous Wed Aug 24 21:59:20 2022 No.31596526 >>31595953 >>31596076 >>31595918 OH BOY I CANT WAIT FOR THE SIMP SHU TO COME IN AND MUNCH MUNCH MUNCH DURING THE LOTR SCENES

>>	Anonymous Wed Aug 24 21:59:30 2022 No.31596538 >>31596360 I would cum instantly...

>>	Anonymous Wed Aug 24 21:59:40 2022 No.31596545 >>31596497 I bet it was hard because of equipment for their avatar, not to Mention in Millie's part that she had to do it in a walk in closet.

>>	Anonymous Wed Aug 24 22:00:07 2022 No.31596565 https://www.youtube.com/watch?v=VvkRFUf_ODY Chima starting her wild 550k stream

>>	Anonymous Wed Aug 24 22:00:11 2022 No.31596569 >>31596497 >choose exercises that are so easy nobody should fail doing them >somehow the hikkineets that always tell their paypigs to touch grass fail ssg

>>	Anonymous Wed Aug 24 22:00:41 2022 No.31596602 >>31596417 Don't become like one of the saplings with separation anxiety.

>>	Anonymous Wed Aug 24 22:00:42 2022 No.31596604 >>31596526 fuck you for jinxing it

>>	Anonymous Wed Aug 24 22:01:06 2022 No.31596625 >>31596076 >>31595918 LET ME JOIN NIJISANJI, NOOR LET ME QUOTE LOTR WITH VOX LET ME TALK ABOUT THE PS2 GAMES THIS ISN'T FAIR

>>	Anonymous Wed Aug 24 22:01:17 2022 No.31596636 File: 172 KB, 322x352, 1661310628848540.png [View same] [iqdb] [saucenao] [google] >>31596145 Would it finally help her incline?

>>	Anonymous Wed Aug 24 22:01:20 2022 No.31596642 >>31596526 Vox unironically has the balls to tell shu off

>>	Anonymous Wed Aug 24 22:01:27 2022 No.31596647 >>31596526 "Oh hey... munch munch [REALLY IMPORTANT CHARACTER] dies here lol"

>>	Anonymous Wed Aug 24 22:02:36 2022 No.31596730 >>31596642 And then he'll get even more antis.

>>	Anonymous Wed Aug 24 22:02:42 2022 No.31596736 >>31596642 I like Vox a lot. What I don't like is he can't seem to install an off-switch on his fujobaiting. So he's talking about lewd stuff in front of the girls in collabs which is very uncomfortable.

>>	Anonymous Wed Aug 24 22:02:46 2022 No.31596739 File: 585 KB, 2000x3000, 1635859152760.jpg [View same] [iqdb] [saucenao] [google] Finana anal

>>	Anonymous Wed Aug 24 22:03:09 2022 No.31596764 >>31596497 They’re simple exercises for warming yourself in the morning dumb mystake

Anonymous Wed Aug 24 22:03:20 2022 No.31596775
File: 740 KB, 2000x2666, 1656603613140.jpg [View same] [iqdb] [saucenao] [google]

https://youtu.be/4TKrTcA-44M
https://youtu.be/4TKrTcA-44M
https://youtu.be/4TKrTcA-44M
FEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEESH

>>	Anonymous Wed Aug 24 22:04:12 2022 No.31596833 File: 727 KB, 546x815, 1656041246648.png [View same] [iqdb] [saucenao] [google] >>31596569 lmao

>>	Anonymous Wed Aug 24 22:04:24 2022 No.31596845 >>31596736 what are you talking about? Im saying Vox has so much autism he will tell Shu to fucking mute when he eats unlike during koshien when no one told shu to stop munching on his fucking chips

>>	Anonymous Wed Aug 24 22:04:33 2022 No.31596850 File: 162 KB, 243x240, finanasoy.png [View same] [iqdb] [saucenao] [google] >>31596775 FEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEESH

>>	Anonymous Wed Aug 24 22:05:07 2022 No.31596898 >>31596775 >Lamb game Is there enough variation in this game that every single fucking person in EN will have fairly different shit happening?

>>	Anonymous Wed Aug 24 22:05:21 2022 No.31596913 File: 218 KB, 421x478, 1654730114294.png [View same] [iqdb] [saucenao] [google] My feeshwife is so cute today!

>>	Anonymous Wed Aug 24 22:05:25 2022 No.31596917 >>31596730 at this point his autism for lotr will outwieght the bullshit people will cry about Hoping Fulgur is there so they can both nerd out(but not too hard to ruin the experience)

>>	Anonymous Wed Aug 24 22:05:34 2022 No.31596932 >>31596845 Yeah but he'd also say stuff about dicks and cum which is almost more annoying than the munching

>>	Anonymous Wed Aug 24 22:05:54 2022 No.31596955 File: 321 KB, 2048x2009, 1648669675466.jpg [View same] [iqdb] [saucenao] [google] >>31596145 loli Reimu model

>>	Anonymous Wed Aug 24 22:06:01 2022 No.31596965 >>31596625 >LET ME TALK ABOUT THE PS2 GAMES Based. The two towers game was fun, I always played as gimli with my brother

>>	Anonymous Wed Aug 24 22:06:40 2022 No.31597006 Elira talking about how cute pomu's thumbnail is for her stream today

>>	Anonymous Wed Aug 24 22:06:42 2022 No.31597010 >>31596917 They will.

>>	Anonymous Wed Aug 24 22:07:12 2022 No.31597039 >>31596917 on my knees begging fuuchan to join this

Anonymous Wed Aug 24 22:07:21 2022 No.31597047
File: 338 KB, 800x800, FAdePKcVkAoeRWv.png [View same] [iqdb] [saucenao] [google]

JUST FIVE HOURS JUST FUCKING FIVE (5) MORE HOURS UNTIL PETRA GURIN (PETOWA GUWIN) REVEALS HER ABILITY TO PERFORM HANDJOBS I HAVE BEEN HOLDING IT SO MUCH PENTOMOS OUR TIME HAS FINALLY CUM UOOOOOOHHH

>>	Anonymous Wed Aug 24 22:08:01 2022 No.31597089 File: 1.36 MB, 1000x2086, Pomu.Rainpuff.full.3332823.png [View same] [iqdb] [saucenao] [google] I thought Pomu was reading a story today. What's this? https://www.youtube.com/watch?v=SuEkU4s-hOw

>>	Anonymous Wed Aug 24 22:08:07 2022 No.31597095 >>31595948 Actually I wasn't aware of that..maybe I'll go with this guy https://www.pixiv.net/en/users/78469182/illustrations

>>	Anonymous Wed Aug 24 22:08:14 2022 No.31597100 >>31596526 If Shu started crunching in my goddamn ear during Boromir's death scene, I would be so fucking pissed you have no goddamn clue.

>>	Anonymous Wed Aug 24 22:08:27 2022 No.31597115 >>31597089 sex stream, with me, yeah. me.

>>	Anonymous Wed Aug 24 22:09:09 2022 No.31597154 Will Aia announce her graduation in stream today?

>>	Anonymous Wed Aug 24 22:09:15 2022 No.31597158 File: 120 KB, 1280x1280, 1577258436132813.jpg [View same] [iqdb] [saucenao] [google] Aia is here!!!!

>>	Anonymous Wed Aug 24 22:09:21 2022 No.31597163 >>31596076 I can host the lotr one but finding a non extended version of hp is really difficult for some reason.

>>	Anonymous Wed Aug 24 22:09:37 2022 No.31597181 >>31596076 Woah shit I was just about to rewatch it after I spent like a week torrenting the extended edition blu rays. Can't fucking wait.

>>	Anonymous Wed Aug 24 22:09:38 2022 No.31597182 >>31597047 who cares about your penguin whore pentomo tell her to suck my billy willy

>>	Anonymous Wed Aug 24 22:09:45 2022 No.31597188 >>31597089 I'm not feeling well so story time is postponed but idk if I'll still stream today but I made this just in case I do stream but I also don't know what to stream

>>	Anonymous Wed Aug 24 22:10:15 2022 No.31597219 >>31596917 If Fuuchan's there and he's sperging about LOTR with Vox, that'll be the stream of the year for me.

>>	Anonymous Wed Aug 24 22:10:26 2022 No.31597231 >>31596636 Most likely yeah.

>>	Anonymous Wed Aug 24 22:10:50 2022 No.31597255 >>31596932 the girls are comfortable with those jokes they are not 10 years old

>>	Anonymous Wed Aug 24 22:11:03 2022 No.31597268 >>31597047 But what if I prefer flipperjobs?

>>	Anonymous Wed Aug 24 22:11:27 2022 No.31597288 >>31596526 Imagine shu ike and aia watchalong

>>	Anonymous Wed Aug 24 22:11:43 2022 No.31597304 >>31597089 mystery

>>	Anonymous Wed Aug 24 22:12:00 2022 No.31597320 >>31597188 Stream yourself masturbating

>>	Anonymous Wed Aug 24 22:12:18 2022 No.31597342 I feel like watching LOTR with people who have already seen it, is not a good idea

>>	Anonymous Wed Aug 24 22:12:22 2022 No.31597348 >>31597288 MUNCH MUCH COUGH MUNCH COUGH COUGH MUNCH

>>	Anonymous Wed Aug 24 22:12:24 2022 No.31597352 >>31597095 Those Amamiya and Gibara arts are pretty nice, and they're just asking for 7000 yen, looks like a decent choice.

>>	Anonymous Wed Aug 24 22:12:50 2022 No.31597373 >>31597255 If he said that stuff in a group of guys, you know what the reaction would be? He'd get clocked in the head

>>	Anonymous Wed Aug 24 22:13:14 2022 No.31597399 File: 93 KB, 201x296, 1658109105996544.png [View same] [iqdb] [saucenao] [google] >>31597047 shuddup bich i will give you a knife job

>>	Anonymous Wed Aug 24 22:13:32 2022 No.31597421 >>31597342 Why? I literally cry every time.

>>	Anonymous Wed Aug 24 22:13:38 2022 No.31597427 >>31597373 You have to be 18 years old to use this website.

>>	Anonymous Wed Aug 24 22:14:09 2022 No.31597456 >>31596526 Petra will ask who is sauron

>>	Anonymous Wed Aug 24 22:14:29 2022 No.31597472 >>31597421 Okay? I didnt ask about you

>>	Anonymous Wed Aug 24 22:15:02 2022 No.31597511 File: 262 KB, 1536x2048, FakjZIOUUAA6Bbe.jpg [View same] [iqdb] [saucenao] [google] >>31597089 mystarias

>>	Anonymous Wed Aug 24 22:15:11 2022 No.31597516 >>31597342 It's a mixed group, so it'll actually be pretty good, since the lore autists can explain everything to the newcomers. I hope at least one of them has read the silmarillion

>>	Anonymous Wed Aug 24 22:15:20 2022 No.31597531 >>31597472 That post was written by Fulgur, anon.

>>	Anonymous Wed Aug 24 22:15:29 2022 No.31597536 >>31597399 GOD YES PENTOMO FREE ME OF MY FORESKIN THEN SUCK MY COCK LIKE THOSE JEWISH PEOPLE DO DURING CIRCUMCISIONS

>>	Anonymous Wed Aug 24 22:15:50 2022 No.31597555 >>31597373 female and/or friendless hands typed this

>>	Anonymous Wed Aug 24 22:16:24 2022 No.31597595 >>31597288 petra too

>>	Anonymous Wed Aug 24 22:16:51 2022 No.31597619 >>31597399 is this rapebait

>>	Anonymous Wed Aug 24 22:17:17 2022 No.31597640 File: 47 KB, 192x192, 1635612276306.png [View same] [iqdb] [saucenao] [google] Finana making Bee-mu

>>	Anonymous Wed Aug 24 22:17:32 2022 No.31597650 >>31597516 the movie explains the lore

>>	Anonymous Wed Aug 24 22:17:39 2022 No.31597659 >>31597373 lmao are you in highschool or are you just a woman?

>>	Anonymous Wed Aug 24 22:17:47 2022 No.31597667 File: 1.86 MB, 2000x2000, 1658835983681.png [View same] [iqdb] [saucenao] [google] >>31597511 I wonder how popular Mysta would be /here/ if he were a girl.

>>	Anonymous Wed Aug 24 22:18:03 2022 No.31597683 listening to finana and aia at the same time is giving me a raging boner

Anonymous Wed Aug 24 22:18:05 2022 No.31597684

I'm still wondering as to why Millie thinks using Kikkoman s o y sause and Kikkoman vinegar for her Adobo stream will get her cancelled by Flips. That thinking is why she delayed the stream initially 11pm but then moved it earlier to 8:00pm so everyone could support Petra's new outfit.

>>	Anonymous Wed Aug 24 22:18:40 2022 No.31597725 >Elira’s Cult of the lamb was at almost 3k >Feesh at 700 with her playthrough How can we save her?

>>	Anonymous Wed Aug 24 22:18:58 2022 No.31597747 I'm still waiting for Scarle to play Wizardry 0-8 and then the japanese spin-offs

>>	Anonymous Wed Aug 24 22:19:00 2022 No.31597750 File: 337 KB, 1112x328, Slow day.png [View same] [iqdb] [saucenao] [google] Slow day it seems.

>>	Anonymous Wed Aug 24 22:19:14 2022 No.31597759 >>31597595 >COUGH COUGH COUGH COUGH >MUNCH MUNCH MUNCH MUNCH >CRUNCH CRUNCH CRUNCH CRUNCH >WHO THE FUCK IS SAURON

>>	Anonymous Wed Aug 24 22:19:28 2022 No.31597774 >>31597750 fuck off numberfag

>>	Anonymous Wed Aug 24 22:19:45 2022 No.31597791 >>31597650 I mean the extra lore, like why Gandalf can fight the balrog and why he comes back as Gandalf the white

>>	Anonymous Wed Aug 24 22:19:55 2022 No.31597809 Astussy soon https://twitter.com/pudding_sleepy/status/1562555650429054976

>>	Anonymous Wed Aug 24 22:19:56 2022 No.31597810 >>31597667 Boys make the best girls. If he was a woman I wouldn't like him as much

>>	Anonymous Wed Aug 24 22:20:00 2022 No.31597814 >>31597725 You don't save someone that shoots themselves.

>>	Anonymous Wed Aug 24 22:20:02 2022 No.31597815 Why is Selen's Outlast stream doing so well? Is she being a scaredycat?

>>	Anonymous Wed Aug 24 22:20:27 2022 No.31597836 >>31597759 who the fuck is sauron?

>>	Anonymous Wed Aug 24 22:20:44 2022 No.31597845 File: 25 KB, 800x74, 1661315984709351.jpg [View same] [iqdb] [saucenao] [google] >>31597815 pic related

>>	Anonymous Wed Aug 24 22:20:48 2022 No.31597852 >>31597684 some people are really anal about their o n i o n s sauce. maybe i'm an autist but brands do taste different from one another, i found my favorite and i just buy that one now.

>>	Anonymous Wed Aug 24 22:21:14 2022 No.31597867 File: 251 KB, 381x446, 1659413939915842.png [View same] [iqdb] [saucenao] [google] >>31597750

>>	Anonymous Wed Aug 24 22:21:47 2022 No.31597897 >>31597791 Somebody has to explain how fucking long Gandalf takes to actually finish the fight with the Balrog and how convoluted the fight is.

>>	Anonymous Wed Aug 24 22:21:57 2022 No.31597915 >>31597809 bro that's gay

>>	Anonymous Wed Aug 24 22:21:59 2022 No.31597918 >>31595918 Watchalong anon better get the movies ready

>>	Anonymous Wed Aug 24 22:22:22 2022 No.31597943 >>31597725 Finana, Nina, and Aia should just graduate. It's getting embarrassing to be quite honest.

>>	Anonymous Wed Aug 24 22:22:42 2022 No.31597957 >>31597852 I'm guessing it's because Kikkoman is usually for sushi or sashimi. If the type of s o y sauce she's using is all purpose and not specially for sushi or sashimi, then she should be fine.

>>	Anonymous Wed Aug 24 22:22:45 2022 No.31597961 At least Aia is good at interacting with chat

>>	Anonymous Wed Aug 24 22:22:48 2022 No.31597967 >>31597815 Baiting scaredycat reactions, scary game buff, basically no competition from the other streams right now.

>>	Anonymous Wed Aug 24 22:23:05 2022 No.31597982 File: 1.00 MB, 2079x2953, 1661379771996.jpg [View same] [iqdb] [saucenao] [google] 31597750

>>	Anonymous Wed Aug 24 22:23:11 2022 No.31597989 >>31597897 give me a rundown

>>	Anonymous Wed Aug 24 22:23:32 2022 No.31598013 >>31597961 She ignored all my messages, so I dropped her

>>	Anonymous Wed Aug 24 22:23:37 2022 No.31598021 >>31597918 Yeee I'll get them ready. I'm also gonna see about cytube viability. No promises

>>	Anonymous Wed Aug 24 22:23:43 2022 No.31598026 >>31597750 aia ina finana elira and selen should graduate

>>	Anonymous Wed Aug 24 22:24:02 2022 No.31598041 Elira's brain is digging up long forgotten associations in playing this again I've enjoyed her Earthbound playthough but it is indeed very niche

>>	Anonymous Wed Aug 24 22:24:54 2022 No.31598090 >>31597957 isn't kikkoman a bit more sweeter than the flip brand, datu puti?

>>	Anonymous Wed Aug 24 22:25:07 2022 No.31598107 >>31598021 No promises about cytube* We'll definitely have them ready on ninisani

>>	Anonymous Wed Aug 24 22:25:30 2022 No.31598129 >>31597815 The power of gap moe is helping things along

>>	Anonymous Wed Aug 24 22:25:51 2022 No.31598144 when is the hp and lotr watchalong? can someone give me a time

>>	Anonymous Wed Aug 24 22:26:17 2022 No.31598170 i fapped to girl_dm's new cat model

>>	Anonymous Wed Aug 24 22:26:38 2022 No.31598195 >>31598144 no

>>	Anonymous Wed Aug 24 22:26:45 2022 No.31598200 >>31597791 sounds like something vox would do. fuuchan maybe, but i remember he said he couldn't get through the books. don't remember if he meant lotr or the hobbit though

>>	Anonymous Wed Aug 24 22:27:03 2022 No.31598218 i think elira should do fantastic beasts watchalong

>>	Anonymous Wed Aug 24 22:27:03 2022 No.31598217 >>31598144 HP is in Elira's 12hr member stream this Friday LOTR is next Saturday, no time yet, Elira was thinking around 1pm EST but no hard confirm

>>	Anonymous Wed Aug 24 22:27:13 2022 No.31598226 >>31598195 fine i will just watch them by myself

>>	Anonymous Wed Aug 24 22:27:18 2022 No.31598233 >>31598170 wait this isn't /lig/ sorry bout that bros

>>	Anonymous Wed Aug 24 22:27:43 2022 No.31598266 >>31598233 post her model

>>	Anonymous Wed Aug 24 22:27:51 2022 No.31598269 >>31598026 >finana >fina >ina THEY ARE

>>	Anonymous Wed Aug 24 22:28:15 2022 No.31598296 File: 756 KB, 1398x1462, FWrwKFZVUAAv2Sh.jpg [View same] [iqdb] [saucenao] [google] >>31598217 thank you

>>	Anonymous Wed Aug 24 22:28:21 2022 No.31598303 i think vox should do star wars 7-9 watchalong

>>	Anonymous Wed Aug 24 22:29:15 2022 No.31598347 >>31598266 https://youtu.be/O8l5y1ego9w

>>	Anonymous Wed Aug 24 22:29:43 2022 No.31598377 i think someone should do a gintama watchalong

>>	Anonymous Wed Aug 24 22:29:58 2022 No.31598393 >>31598347 what the fuck bro

>>	Anonymous Wed Aug 24 22:30:02 2022 No.31598403 >>31598347 luca.....

>>	Anonymous Wed Aug 24 22:30:23 2022 No.31598422 >my 3 wifes are streaming at the same time AAAAAAAARGHH

>>	Anonymous Wed Aug 24 22:30:28 2022 No.31598427 >>31597667 Scarle...

>>	Anonymous Wed Aug 24 22:30:41 2022 No.31598437 >Aia literally doubled her viewers in a day Aiantifabros I guess we're coming home

>>	Anonymous Wed Aug 24 22:30:42 2022 No.31598440 >>31597967 Outlast isn't a buff this many years later, anon.

>>	Anonymous Wed Aug 24 22:31:02 2022 No.31598452 https://www.youtube.com/watch?v=N7Ddcm41efQ

>>	Anonymous Wed Aug 24 22:31:03 2022 No.31598453 >>31598377 based. someone needs to strap fulgur to a chair during that after his crimes against gintama

>>	Anonymous Wed Aug 24 22:31:36 2022 No.31598488 >>31598303 I want empire or rogue one instead

>>	Anonymous Wed Aug 24 22:31:36 2022 No.31598486 >>31598393 >>31598403 I like her sassy personality and it makes me hard

>>	Anonymous Wed Aug 24 22:31:38 2022 No.31598490 I hope someone do a watchalong but shit on this movie

>>	Anonymous Wed Aug 24 22:31:44 2022 No.31598505 TREERRAT??

>>	Anonymous Wed Aug 24 22:32:11 2022 No.31598538 >>31598453 he doesn't like gintama? unbased

>>	Anonymous Wed Aug 24 22:32:16 2022 No.31598540 >>31597791 I hope there’s a lore autist in the watchalong. A lot of them hated some of the artistic freedom Jackson did, like the witch king vs Gandalf scene

>>	Anonymous Wed Aug 24 22:32:36 2022 No.31598558 >>31598490 harry potter fucking sucks so hopefully nini-anon gets it and streams it for us

>>	Anonymous Wed Aug 24 22:32:39 2022 No.31598564 >>31598303 no one want to watch 7-9 with him

>>	Anonymous Wed Aug 24 22:32:53 2022 No.31598577 >>31598538 no, it's not that he doesn't like it, he's a fucking gintama clipfag.

>>	Anonymous Wed Aug 24 22:33:13 2022 No.31598604 >>31598490 someone already did

>>	Anonymous Wed Aug 24 22:33:24 2022 No.31598614 File: 105 KB, 248x248, Fina Sad.png [View same] [iqdb] [saucenao] [google] I know Finana is in this state from her own actions, but I hope she doesn't drop this game for more valorants/league/gacha. I just want the old Lazulight dynamic back

>>	Anonymous Wed Aug 24 22:33:50 2022 No.31598640 File: 71 KB, 720x690, 1623882197491.jpg [View same] [iqdb] [saucenao] [google] >>31598303 Jesus fuck why would anyone want that?

>>	Anonymous Wed Aug 24 22:34:23 2022 No.31598671 File: 59 KB, 435x525, 1650158644503.jpg [View same] [iqdb] [saucenao] [google] >>31598577 how dare him

>>	Anonymous Wed Aug 24 22:34:39 2022 No.31598683 >>31598640 vox says he loves tlj

>>	Anonymous Wed Aug 24 22:34:53 2022 No.31598697 >>31598614 give it up bro, old story-based playing finana kino is dead, league/valorant with aster is the new thing unless elira and pomu fix feesh on their trip to japan, im praying for the unity to be restored there

>>	Anonymous Wed Aug 24 22:35:13 2022 No.31598715 >>31598090 Stronger flavor compared to Knorr or Silver Swan.

>>	Anonymous Wed Aug 24 22:35:48 2022 No.31598751 ah manga magazines... I miss Bunch

>>	Anonymous Wed Aug 24 22:36:15 2022 No.31598776 >>31598347 What the fuck

>>	Anonymous Wed Aug 24 22:37:18 2022 No.31598820 File: 190 KB, 1378x1386, FLz7X7FVEAM6CZL.jpg [View same] [iqdb] [saucenao] [google] >>31598452 Kino

>>	Anonymous Wed Aug 24 22:37:37 2022 No.31598829 >>31598614 IT'S OVER ANON. LET IT GO. I know it hurts, but you've to accept the reality.

>>	Anonymous Wed Aug 24 22:37:55 2022 No.31598849 I want someone to do literally me movies watchalong

>>	Anonymous Wed Aug 24 22:38:16 2022 No.31598869 >>31598486 I like her fat ass tits. Too bad she is bipolar so it's a nono.

>>	Anonymous Wed Aug 24 22:38:19 2022 No.31598871 File: 2.50 MB, 1926x3140, 1652336570041.png [View same] [iqdb] [saucenao] [google] I CANT STOP LOOKING AT PONTO'S PUBES UNDERNEATH HER WHITE TIGHTS ON THAT DOUJIN THAT WAS LINKED ON THE LAST THREAD FUCK

Anonymous Wed Aug 24 22:38:37 2022 No.31598885

>>31597989
They fall into the frozen waters and fight
Then Gandalf chases the Balrog into deep tunnels that were created by unnamed Lovecraftian creatures that are still gnawing at world.
Both of them then fled the tunnels because they don't want to deal with the nightmarish abominations older than Sauron
They both ended up at the foot of these stairs that are ancient and nigh-mythological, and fought all the way up that staircase until they reached the summit of the mountain, destroyed an ancient Dwarven castle, and then he managed to get the Balrog to fall off the mountain.

>>	Anonymous Wed Aug 24 22:38:52 2022 No.31598905 >>31598849 yeah, me

>>	Anonymous Wed Aug 24 22:39:05 2022 No.31598914 >>31598614 Accept it, anon. As you said, it's due to her own actions so now she's doing what she can and knows best.

>>	Anonymous Wed Aug 24 22:39:24 2022 No.31598933 >>31598683 He's a retarded shipper crazy about the romance. Everything else about those movies is utter garbage.

>>	Anonymous Wed Aug 24 22:39:56 2022 No.31598968 >>31598885 that sounds dumb as shit and feels like he just wanted to write that in but didn't know where to include it in the story

>>	Anonymous Wed Aug 24 22:39:57 2022 No.31598970 >>31598905 ok sonny

>>	Anonymous Wed Aug 24 22:40:01 2022 No.31598976 >>31598697 I'm afraid Finana will just go with some of the other groups that will be attending the event. I worry for her during the trip with how bratty she was with Pomu

>>	Anonymous Wed Aug 24 22:40:08 2022 No.31598981 File: 447 KB, 683x636, file.png [View same] [iqdb] [saucenao] [google] >>31598871

>>	Anonymous Wed Aug 24 22:40:25 2022 No.31598999 Has Reimu already encountered Mr. X in her RE2 stream? I slept so I could watch the collab with Fuwa Minato.

>>	Anonymous Wed Aug 24 22:40:47 2022 No.31599028 >>31598885 what the fuck? thats some tom and jerry fucking sequence also >unnamed Lovecraftian creatures that are still gnawing at world. >the nightmarish abominations older than Sauron the fuck

>>	Anonymous Wed Aug 24 22:41:21 2022 No.31599052 >>31598452 FUCKING SIMP

>>	Anonymous Wed Aug 24 22:42:33 2022 No.31599130 Elira is dying again

>>	Anonymous Wed Aug 24 22:43:00 2022 No.31599158 Elira choking on gummies then eating more

>>	Anonymous Wed Aug 24 22:43:04 2022 No.31599163 >Aia's mom watched Vox's ASMR OH NO NO NO

>>	Anonymous Wed Aug 24 22:43:46 2022 No.31599204 File: 384 KB, 768x900, FSDFohxaQAIE_MT.png [View same] [iqdb] [saucenao] [google] >>31598981 MAKES ME HARDER THAN ANY SORT OF SEX OR FETISH WHATSOEVER

>>	Anonymous Wed Aug 24 22:44:19 2022 No.31599233 >>31599163 at this point, we can just assume that every asian women watched it

>>	Anonymous Wed Aug 24 22:44:23 2022 No.31599239 >Selen is low energy after working so hard on projects she's just like me, I'm so tired

>>	Anonymous Wed Aug 24 22:44:25 2022 No.31599244 >what is Otsu >what is a rainbow Aia can you do the basic of research...

>>	Anonymous Wed Aug 24 22:44:34 2022 No.31599255 File: 117 KB, 1080x1080, Fa0zN2CUIAAHr4y.jpg [View same] [iqdb] [saucenao] [google] I want to fuck a penguin. Or be fucked by one. It doesn't really matter.

>>	Anonymous Wed Aug 24 22:44:38 2022 No.31599258 >>31599163 Any news about her graduation? Did she announce it yet?

>>	Anonymous Wed Aug 24 22:44:49 2022 No.31599270 I hope one day a Nijien gets into a mobage like this https://twitter.com/NemunokiVVV/status/1562382259692654592

>>	Anonymous Wed Aug 24 22:44:52 2022 No.31599274 >>31599163 oh nononononono Aia's mom will try to use her to get to Vox

>>	Anonymous Wed Aug 24 22:45:19 2022 No.31599312 >>31599163 >elira's mom >shu's mom >reimu's mom's mom >sonny's mom >aia's mom vox is mom slayer......

>>	Anonymous Wed Aug 24 22:45:27 2022 No.31599321 >>31598452 was it really that funny

>>	Anonymous Wed Aug 24 22:45:29 2022 No.31599325 this selen sounds cuter than usual did they change her VA?

Anonymous Wed Aug 24 22:45:49 2022 No.31599348

>>31599239
>working hard
>hiring underpaid artists and modellers and overworking them with 2 hour deadlines an hour before it's due because your bad at time management and think using your clout as a big streamer isn't extremely shitty

You'd think as a former artist she'd understand to NOT do this shit.

>>	Anonymous Wed Aug 24 22:45:51 2022 No.31599349 File: 888 KB, 2896x4096, 1640772448442.jpg [View same] [iqdb] [saucenao] [google] >>31599255 would you?

>>	Anonymous Wed Aug 24 22:46:16 2022 No.31599375 >>31599321 no...

>>	Anonymous Wed Aug 24 22:46:18 2022 No.31599377 >>31599312 >shu's mom >reimu's mom's mom when did these get mentioned?

>>	Anonymous Wed Aug 24 22:47:07 2022 No.31599427 >>31598885 I need to reread/watch LOTR

>>	Anonymous Wed Aug 24 22:47:20 2022 No.31599440 Selen's voice is falling apart.

>>	Anonymous Wed Aug 24 22:47:52 2022 No.31599477 File: 761 KB, 1046x1300, FBE9fh8VIAAJYQW.jpg [View same] [iqdb] [saucenao] [google] >>31599349 Gender doesn't matter as long as he's got the fluffy tail. I wouldn't fuck Shu because he doesn't have the right penguin bits.

>>	Anonymous Wed Aug 24 22:48:12 2022 No.31599503 >>31599377 I can't remember but shu said his dad is dragoon , mom is kindred, big sis is nystake and little sis is lucub

>>	Anonymous Wed Aug 24 22:48:23 2022 No.31599518 >>31598999 Nobody here watched her stream, she's less popular than Aia now unironically..

Anonymous Wed Aug 24 22:48:30 2022 No.31599530

Just fucking read Warhammer Fantasy, it's better than LOTR in every way.
Even has a SUPER depressing ending where everyone dies to some overpowered rats because games workshop cant write (no seriously how does chaos and all these huge armies that were set up for years as invincible lose to rats who want to nuke the moon)

>>	Anonymous Wed Aug 24 22:48:40 2022 No.31599542 based Selen

>>	Anonymous Wed Aug 24 22:49:02 2022 No.31599572 >Vox's mom watches his ASMR streams

>>	Anonymous Wed Aug 24 22:49:52 2022 No.31599637 >>31598614 Honestly it seems like today is suffering for literally everyone. Elira doesn't even have 1k on earthbound. The thread is dead and the only person in the 4 digit range is doing a horror marathon.

>>	Anonymous Wed Aug 24 22:50:33 2022 No.31599687 >>31599530 90% of warhammer books are shit.

>>	Anonymous Wed Aug 24 22:51:41 2022 No.31599758 >>31599687 Not unlike the games.....

>>	Anonymous Wed Aug 24 22:52:25 2022 No.31599811 Feesh is illiterate...

>>	Anonymous Wed Aug 24 22:52:43 2022 No.31599834 File: 69 KB, 480x480, 1655742657056.png [View same] [iqdb] [saucenao] [google] >>31597511

>>	Anonymous Wed Aug 24 22:53:13 2022 No.31599866 >>31597511 Mating press!

>>	Anonymous Wed Aug 24 22:53:14 2022 No.31599868 It's funny how doomposted Kyo was, but he and Maria ended up being the best if Iluna

>>	Anonymous Wed Aug 24 22:53:23 2022 No.31599878 >>31599321 no.....

>>	Anonymous Wed Aug 24 22:54:21 2022 No.31599940 File: 47 KB, 185x199, rat.png [View same] [iqdb] [saucenao] [google] thoughts on this rrat?

>>	Anonymous Wed Aug 24 22:55:12 2022 No.31600002 >>31599868 The thread was right about Aia though

>>	Anonymous Wed Aug 24 22:55:46 2022 No.31600038 File: 8 KB, 265x54, 1650629388722.png [View same] [iqdb] [saucenao] [google] What's the context on this

>>	Anonymous Wed Aug 24 22:56:11 2022 No.31600074 >>31599868 Scarle and Ren are better than Maria

>>	Anonymous Wed Aug 24 22:56:18 2022 No.31600079 >>31600002 >caring about anons' opinions low test detected

>>	Anonymous Wed Aug 24 22:56:23 2022 No.31600087 >>31598999 No, she stopped before she even really did anything.

>>	Anonymous Wed Aug 24 22:56:38 2022 No.31600106 >>31599868 Thread was wrong about Scarle too but for the wrong reasons. She's good too, just fills a different niche than a lot of people wanted. I think Maria is boring as sin though.

>>	Anonymous Wed Aug 24 22:56:48 2022 No.31600111 >>31600087 Oh. Thanks.

>>	Anonymous Wed Aug 24 22:56:49 2022 No.31600113 >>31600038 Elira's doing a public LoTR extended edition watchalong next week. Anybody in EN is free to join

>>	Anonymous Wed Aug 24 22:56:50 2022 No.31600116 >>31600074 don't talk bad about maria

>>	Anonymous Wed Aug 24 22:57:04 2022 No.31600133 >>31600074 >Ren >better than anyone

>>	Anonymous Wed Aug 24 22:57:13 2022 No.31600144 >>31600038 lotr watchalong

Anonymous Wed Aug 24 22:57:28 2022 No.31600162

>>31599530
How can you compare the two?
Lord of the Rings is an epic fantasy written by an oxford professor that completely redefined English mythological history. Warhammer is some amalgamation of Star Wars, LOTR, Highlander, and various other things to create a tabletop RPG game

>>	Anonymous Wed Aug 24 22:57:29 2022 No.31600163 >>31600002 You gotta be dumb to ignore such obvious red flag like her pre debut tweets.

>>	Anonymous Wed Aug 24 22:57:31 2022 No.31600166 >>31600038 someone in chat said they had plans but were cancelling them to watch the LOTR watchalong. he either misspelled 'chat', or called them a chad

>>	Anonymous Wed Aug 24 22:57:57 2022 No.31600192 >>31600113 >>31600144 >>31600166 Unbelievably based of her

>>	Anonymous Wed Aug 24 22:58:14 2022 No.31600216 >>31600133 Yes

>>	Anonymous Wed Aug 24 22:58:32 2022 No.31600228 File: 385 KB, 588x1376, Pomu_&_Malcodor_The_Sigilite.jpg [View same] [iqdb] [saucenao] [google] All hail The mighty Pomu Emperor of Mankind

>>	Anonymous Wed Aug 24 22:58:45 2022 No.31600242 selen getting tired of seeing cocks in game and currently looking for women

>>	Anonymous Wed Aug 24 22:58:56 2022 No.31600256 >>31600106 Definitely. She's a sistuber instead of a mommy, but that's not bad it just isn't everyone's thing

Anonymous Wed Aug 24 22:58:56 2022 No.31600257

I really don't understand how Earthbound of all games is a debuff game. I mean, everyone likes Earthbound, even people that hasn't played it say they like it because of peer pressure and Omori, a game that's so heavily inspired on Earthbound that sometimes just comes across as a ripoff is a buff game in this branch. Why the fuck is Earthbound a debuff

Anonymous Wed Aug 24 22:59:29 2022 No.31600297

>>31599348
>hiring underpaid artists and modellers and overworking them with 2 hour deadlines an hour before it's due
Never happened. She specifically asked if anyone can FINISH part of a project within a deadline, which many artists WILL HAPPILY DO as long as you're paying them the worth of the project, which Selen does. There's a reason artists fall over themselves to work with Nijisanji and Hololive to the point they tell indies/other commissioners to fuck off. If you're going to shit post at least post the whole story, we get it's basically a dead day.
>>31599868
People only doomposted about Kyo because the underage white kids think he's a black person.

>>	Anonymous Wed Aug 24 22:59:30 2022 No.31600301 Aia is kinda like Yugo imo. Once she learns how to steam she'll be entertaining enough

>>	Anonymous Wed Aug 24 22:59:47 2022 No.31600319 File: 294 KB, 350x512, 1657808821115.png [View same] [iqdb] [saucenao] [google] >Selen reading MK ULTRA as MacUltra

>>	Anonymous Wed Aug 24 23:00:04 2022 No.31600335 >>31600228 >god emperor is a cripple slowly rotting in a wheel chair >Pomu is a cripple slowly rotting in a wheel chair >I'm a cripple slowly rotting in a wheel chair WE ARE?!

>>	Anonymous Wed Aug 24 23:00:19 2022 No.31600353 >>31600162 Based autist

>>	Anonymous Wed Aug 24 23:00:36 2022 No.31600374 >>31600257 Debuff day in general honestly.

>>	Anonymous Wed Aug 24 23:00:39 2022 No.31600380 >>31600163 If Aia takes sone initiative, I think management still could salvage the situation. Like graduate the current Aia on medical grounds, amd then hire someone good and launch with modified model of Aia

>>	Anonymous Wed Aug 24 23:00:40 2022 No.31600383 >>31600257 Because it's old and the majority of the vtuber audience are zoomies.

>>	Anonymous Wed Aug 24 23:00:43 2022 No.31600386 >>31600319 She is illiterate please understand

>>	Anonymous Wed Aug 24 23:00:45 2022 No.31600388 >>31600002 I think anons doomposted too hard about Iluna, even Aia, so I kinda disagree.

>>	Anonymous Wed Aug 24 23:00:49 2022 No.31600392 File: 10 KB, 359x86, pom.png [View same] [iqdb] [saucenao] [google] pomu definitely streaming... something

>>	Anonymous Wed Aug 24 23:00:57 2022 No.31600402 >>31600257 >I really don't understand how Earthbound of all games is a debuff game. It's not a debuff game. The girls have been kind of shooting themselves in their face the last few weeks, Finana most of all.

>>	Anonymous Wed Aug 24 23:00:58 2022 No.31600403 >>31600297 People doomposted about Kyo because of that and they expected him to be basically how Ren is. Showing no knowledge of Nijisanji whatsoever

>>	Anonymous Wed Aug 24 23:01:05 2022 No.31600409 >>31600297 Anyone will work with extreme deadlines if it means getting 10,000 dollars lmao ESPECIALLY starving artists doesnt mean its not shitty.

>>	Anonymous Wed Aug 24 23:02:08 2022 No.31600468 Feesh.....

>>	Anonymous Wed Aug 24 23:02:39 2022 No.31600492 Reminder: this is Pomu's period week, please be kind to her and give her enough money for a large tub of chocolate ice cream!

>>	Anonymous Wed Aug 24 23:02:40 2022 No.31600496 >>31600383 But zoomies love Earthbound, if anything they love it too fucking much and it's the only SNES game they know other than Mario World

>>	Anonymous Wed Aug 24 23:02:56 2022 No.31600509 https://www.youtube.com/watch?v=SuEkU4s-hOw https://www.youtube.com/watch?v=SuEkU4s-hOw https://www.youtube.com/watch?v=SuEkU4s-hOw POMU SOON(?)

>>	Anonymous Wed Aug 24 23:03:42 2022 No.31600543 File: 323 KB, 1200x800, pomu 40k.jpg [View same] [iqdb] [saucenao] [google] We are all Pomu!

>>	Anonymous Wed Aug 24 23:03:46 2022 No.31600552 File: 673 KB, 574x718, 1642126698002.png [View same] [iqdb] [saucenao] [google] >>31600492

>>	Anonymous Wed Aug 24 23:03:56 2022 No.31600559 >>31600257 it's the 6th stream of a game she hasn't touched for over 4 months It has always struggled for views though, you're right. Old = bad to some

>>	Anonymous Wed Aug 24 23:04:30 2022 No.31600588 File: 1.48 MB, 450x478, SmartSelect_20220801-210551_Brave.gif [View same] [iqdb] [saucenao] [google] >>31600133 Ren is God tier in collabs. >What buttons could I press...

>>	Anonymous Wed Aug 24 23:04:43 2022 No.31600601 File: 111 KB, 768x1024, FONtNciaUAIrZX_.jpg [View same] [iqdb] [saucenao] [google] I'm surprised none of the boys played Everhood yet. Alban, Ike and Mysta seem like they might pick that game.

Anonymous Wed Aug 24 23:04:53 2022 No.31600613

>>31600297
>which many artists WILL HAPPILY DO as long as you're paying them the worth of the project,
And? That's how it works for many companies. And guess what? Those companies that have horrible deadlines to reach and hire for crunch because they have unrealistic expectations? They're also publicly scrutinized for being shit.
That's how it goes. People accepting those jobs because they need to pay the bills and feed themselves does not suddenly make shitty work environments justifiable.

>>	Anonymous Wed Aug 24 23:04:53 2022 No.31600614 File: 208 KB, 579x796, 1637363636133.png [View same] [iqdb] [saucenao] [google] Petra confirmed for FAT TITS

>>	Anonymous Wed Aug 24 23:04:56 2022 No.31600619 >>31600402 >unprompted shitting on fish obsessed

>>	Anonymous Wed Aug 24 23:05:00 2022 No.31600622 >>31600257 https://hard-drive.net/huge-earthbound-fan-excited-play-first-time/

>>	Anonymous Wed Aug 24 23:05:15 2022 No.31600632 >>31600509 damn I was about to watch the Metal Wolf kino vod I missed yesterday due to work but let's see what Pommers has up her sleeve

>>	Anonymous Wed Aug 24 23:05:31 2022 No.31600643 >>31600257 >SNES JRPG Gee I wonder how.

>>	Anonymous Wed Aug 24 23:05:35 2022 No.31600647 Are prechats always weird as fuck

>>	Anonymous Wed Aug 24 23:05:41 2022 No.31600650 >>31600301 >once she learns to X This is such a bullshit cope. If you can't fix it and can't get the groove on in first few weeks, why are you even here? Numberfagging Noor did this to NIJI EN.

>>	Anonymous Wed Aug 24 23:06:16 2022 No.31600691 >>31600647 no, just don't look on luxiem's prechat especially vox and luca

>>	Anonymous Wed Aug 24 23:06:24 2022 No.31600699 four hours until viewers sees all for new petra?

>>	Anonymous Wed Aug 24 23:06:29 2022 No.31600704 >>31600380 >Aia could improve her situation, just replace the person and the model ???

>>	Anonymous Wed Aug 24 23:06:35 2022 No.31600712 >>31600559 >Old = bad to some And sadly this is why the gamer wave is gonna suck. Zoomies will see a cool dude playing an SNES or PS1 game and then turn away because "the graphics look shit". So we're just gonna get 4 apex dudes.

>>	Anonymous Wed Aug 24 23:06:38 2022 No.31600714 POMU IS DEAD

>>	Anonymous Wed Aug 24 23:06:47 2022 No.31600724 >>31600650 I agree, the first week you have to start STRONG.

>>	Anonymous Wed Aug 24 23:06:53 2022 No.31600729 >>31600509 I guess not. She's sick

>>	Anonymous Wed Aug 24 23:07:06 2022 No.31600742 >>31600601 Rosemi-sama is a tomboy

>>	Anonymous Wed Aug 24 23:07:21 2022 No.31600760 >>31600647 No, just today because everyone's waiting for Pomu

>>	Anonymous Wed Aug 24 23:07:28 2022 No.31600768 Eiwwa keeps teasing that petra's outfit got MMM MM MMMMM tights

>>	Anonymous Wed Aug 24 23:07:31 2022 No.31600772 sex with mysta

>>	Anonymous Wed Aug 24 23:07:42 2022 No.31600784 File: 231 KB, 371x345, 1645754960804.png [View same] [iqdb] [saucenao] [google] >>31600699 Four more hours

>>	Anonymous Wed Aug 24 23:07:43 2022 No.31600785 I feel so bad for pomu always being cursed by the scuff gods

>>	Anonymous Wed Aug 24 23:07:47 2022 No.31600787 pomu has diarrhea let's gooooo

>>	Anonymous Wed Aug 24 23:07:48 2022 No.31600789 >>31600712 I hope it's 3 Apex dudes and one 35-year-old that only plays /vr/ games and goes on hours-long rants about how the PS3 generation ruined gaming

>>	Anonymous Wed Aug 24 23:07:56 2022 No.31600805 >Aia talking about her dates

>>	Anonymous Wed Aug 24 23:08:00 2022 No.31600809 Elira's game froze? SHE IS CURSED

>>	Anonymous Wed Aug 24 23:08:18 2022 No.31600826 Pomu's stream is a surprise idol collab but something is getting in the way at the last minute here

>>	Anonymous Wed Aug 24 23:08:51 2022 No.31600842 File: 293 KB, 1079x995, 1661382511216.jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Wed Aug 24 23:08:55 2022 No.31600851 >>31600826 Which idol? Nana?

>>	Anonymous Wed Aug 24 23:08:58 2022 No.31600857 File: 14 KB, 275x308, 348984.jpg [View same] [iqdb] [saucenao] [google] >>31600789 >and one 35-year-old that only plays /vr/ games and goes on hours-long rants about how the PS3 generation ruined gaming Yeah, I'm getting in.

>>	Anonymous Wed Aug 24 23:08:59 2022 No.31600859 File: 776 KB, 1000x1288, Vox_Akuma_Portrait.png [View same] [iqdb] [saucenao] [google] if I was a vtuber, literally nothing stops me from streaming on the toilet

>>	Anonymous Wed Aug 24 23:09:19 2022 No.31600883 >elira's game freezes >pomu is fucking dying >no one discusses finana NOOO I DONT WANT LAZULIGHT TO DIE I LOVE THEM SO MUCH

>>	Anonymous Wed Aug 24 23:09:22 2022 No.31600886 >>31600851 me

>>	Anonymous Wed Aug 24 23:09:23 2022 No.31600887 >>31600742 I liked her playthrough and remembered about it today, but was really surprised no one else in en touched that game.

>>	Anonymous Wed Aug 24 23:09:31 2022 No.31600893 File: 167 KB, 1330x2048, 1656192952645.jpg [View same] [iqdb] [saucenao] [google] >>31600785 Great powers come with a price

Anonymous Wed Aug 24 23:09:47 2022 No.31600906

>>31600650
En isn't the only branch like this though. In Jp they teach you how to stream because not everyone's gonna understand how to interact with chat and etc.
I forget what it's called. Other anons can tell you more about it for sure. But I do agree it'd be nice if we stopped hiring people for numbers because it's not really been that successful.

>>	Anonymous Wed Aug 24 23:09:49 2022 No.31600911 POMUSUKEEEEEEE

>>	Anonymous Wed Aug 24 23:09:50 2022 No.31600912 POMU ON

>>	Anonymous Wed Aug 24 23:09:51 2022 No.31600914 Stop shitting on Ren but also stop shitting on other Iluna members, they're very comfy, don't ruin this for me

>>	Anonymous Wed Aug 24 23:09:54 2022 No.31600915 >>31600789 Ps3 had some underrated kino though

>>	Anonymous Wed Aug 24 23:10:00 2022 No.31600921 Pomu is live? https://www.youtube.com/watch?v=SuEkU4s-hOw

>>	Anonymous Wed Aug 24 23:10:01 2022 No.31600922 Is that Pomu's pussy on stream?

>>	Anonymous Wed Aug 24 23:10:09 2022 No.31600938 POMUSUKE DOX

>>	Anonymous Wed Aug 24 23:10:16 2022 No.31600944 File: 104 KB, 340x190, file.png [View same] [iqdb] [saucenao] [google] pomus pussy leaked

>>	Anonymous Wed Aug 24 23:10:22 2022 No.31600950 POMUSUKE LIVE https://www.youtube.com/watch?v=SuEkU4s-hOw https://www.youtube.com/watch?v=SuEkU4s-hOw https://www.youtube.com/watch?v=SuEkU4s-hOw

>>	Anonymous Wed Aug 24 23:10:23 2022 No.31600952 File: 171 KB, 362x214, pomusuke.png [View same] [iqdb] [saucenao] [google] POMUSUKE ON POMU'S STREAM THIS IS NOT A DriLL HOLY FUCK

>>	Anonymous Wed Aug 24 23:10:25 2022 No.31600955 IT'S HIM

>>	Anonymous Wed Aug 24 23:10:30 2022 No.31600958 ENTER POMUSUKE????????????

>>	Anonymous Wed Aug 24 23:10:33 2022 No.31600959 POMUSUKE

>>	Anonymous Wed Aug 24 23:10:50 2022 No.31600975 POMUSUKE MY BELOVED

>>	Anonymous Wed Aug 24 23:10:50 2022 No.31600976 KINO STARTING

>>	Anonymous Wed Aug 24 23:10:50 2022 No.31600977 >>31600704 I meant Aia could us a favour by graduating early. It's quite embarrassing for both the management and her.

>>	Anonymous Wed Aug 24 23:10:58 2022 No.31600982 >>31600851 The idol was Pomusuke

>>	Anonymous Wed Aug 24 23:11:01 2022 No.31600985 >pomusuke cam Archiving this stream right now, I have a bad feeling about this

>>	Anonymous Wed Aug 24 23:11:01 2022 No.31600984 What breed is Pomusuke?

>>	Anonymous Wed Aug 24 23:11:02 2022 No.31600987 >>31600915 I know, but it's still where it started all going wrong I'm mostly bitter because that's the gen when I got a girlfriend and she convinced me to "outgrow" video games.

>>	Anonymous Wed Aug 24 23:11:03 2022 No.31600988 POMUSUKE ON TELLY

>>	Anonymous Wed Aug 24 23:11:15 2022 No.31600996 In the year 2022, literally no one should bother with earthbound. I love you elira, but I can’t watch.

>>	Anonymous Wed Aug 24 23:11:17 2022 No.31600998 File: 3.76 MB, 349x372, 1640913416294.gif [View same] [iqdb] [saucenao] [google] POMU'S PUSSY

>>	Anonymous Wed Aug 24 23:11:21 2022 No.31601004 >>31600984 it's a cat

>>	Anonymous Wed Aug 24 23:11:24 2022 No.31601008 How long until we get banned for "Not Vtubers" or some other bullshit for posting Pomusuke because mods don't watch streams. it's happened to me 3 fucking times with Ember

>>	Anonymous Wed Aug 24 23:11:37 2022 No.31601019 pomu doxxes her cat, shut her down again

>>	Anonymous Wed Aug 24 23:11:46 2022 No.31601024 The ULTIMATE CONTENT

>>	Anonymous Wed Aug 24 23:11:48 2022 No.31601028 >>31599377 Reimu tweeted about hers

>>	Anonymous Wed Aug 24 23:11:54 2022 No.31601033 >POMUSKE IS SIAMESE >POMUSKE IS SIAMESE >POMUSKE IS SIAMESE >POMUSKE IS SIAMESE >POMUSKE IS SIAMESE

>>	Anonymous Wed Aug 24 23:11:55 2022 No.31601034 this is a recording right what if pomusuke knock the cam off

>>	Anonymous Wed Aug 24 23:12:09 2022 No.31601048 >>31600987 Girlfriend saved you from 7th gen, but deprived you from delving in on all generations before that.

>>	Anonymous Wed Aug 24 23:12:14 2022 No.31601054 File: 350 KB, 1566x2048, 167390562005.jpg [View same] [iqdb] [saucenao] [google] >>31600805 All me

>>	Anonymous Wed Aug 24 23:12:18 2022 No.31601057 Cute, this is Pomu's way of doing animal cam streams

>>	Anonymous Wed Aug 24 23:12:21 2022 No.31601061 >>31600724 Seriously, things move so fast. If you can't capitalise on the debut buff, don't expect any miracles.

>>	Anonymous Wed Aug 24 23:12:23 2022 No.31601067 BRING BACK POMUSUKE

>>	Anonymous Wed Aug 24 23:12:36 2022 No.31601077 I always thought pomusuke had brown fur

>>	Anonymous Wed Aug 24 23:12:38 2022 No.31601079 >>31600984 looks like burnt bread

>>	Anonymous Wed Aug 24 23:12:43 2022 No.31601084 >>31601033 DAT'S RACIST The proper term is Thai Feline

>>	Anonymous Wed Aug 24 23:12:45 2022 No.31601085 File: 31 KB, 512x512, 1635308783023.png [View same] [iqdb] [saucenao] [google] Its him the stinky boi

>>	Anonymous Wed Aug 24 23:12:46 2022 No.31601087 >>31601008 >spoiler thats because dragoons press the report button, same with other things

>>	Anonymous Wed Aug 24 23:12:56 2022 No.31601102 What Pomu doing ??

>>	Anonymous Wed Aug 24 23:13:00 2022 No.31601105 I love cats so much I would watch him sleep for hours

>>	Anonymous Wed Aug 24 23:13:00 2022 No.31601107 >>31600984 probably Himalayan the bad kind of inbred cat

>>	Anonymous Wed Aug 24 23:13:07 2022 No.31601114 >>31600906 Not every liver comes from VTA

>>	Anonymous Wed Aug 24 23:13:16 2022 No.31601120 this seems like a dumb risk, what if pomusuke says pomu's full real name out loud?

>>	Anonymous Wed Aug 24 23:13:20 2022 No.31601124 >>31601102 her best

>>	Anonymous Wed Aug 24 23:13:28 2022 No.31601131 File: 363 KB, 1100x800, 1643342066718.gif [View same] [iqdb] [saucenao] [google] >>31601085 Is me

>>	Anonymous Wed Aug 24 23:13:29 2022 No.31601132 >>31600984 Some unknown mix I think? I remember Pomu saying her family found a pair of cats, but they had to give one away. The one they kept was Pomusuke.

>>	Anonymous Wed Aug 24 23:13:32 2022 No.31601136 >>31601102 Reading this thread.

>>	Anonymous Wed Aug 24 23:13:55 2022 No.31601161 >>31601120 How many people in Pomu's audience can speak Cat?

>>	Anonymous Wed Aug 24 23:13:56 2022 No.31601163 i hear cicadas outside AND in pomus stream

Anonymous Wed Aug 24 23:13:57 2022 No.31601165

>>31601087
thats literally not how that works though, a janny would still have to file the report, a mod would have to see the report and STILL choose to ban you.

which means jannies and mods are threadwatchers who don't care about the streams they are supposed to be watching.

Anonymous Wed Aug 24 23:14:08 2022 No.31601177
File: 796 KB, 3000x3000, 1634487736336.jpg [View same] [iqdb] [saucenao] [google]

>go to the dentist
>face get numb
>can't feel anything, chew on lip out of habit
>blood starts running down my face
>I chewed my lip to a pulp without realizing
>face all swollen
>still can't feel anything
>waiting for the pain to start

>>	Anonymous Wed Aug 24 23:14:11 2022 No.31601182 Pomusuke is a fat little fuck

>>	Anonymous Wed Aug 24 23:14:18 2022 No.31601184 >>31600409 Indeed. It's shitty but they continue to do it to themselves.

>>	Anonymous Wed Aug 24 23:14:20 2022 No.31601188 >>31601114 True but still. If we're gonna poach people who don't even do live streams. Maybe it'd be good to train them.

>>	Anonymous Wed Aug 24 23:14:24 2022 No.31601191 >>31601120 don't be a retard, he is muted

>>	Anonymous Wed Aug 24 23:14:24 2022 No.31601192 imagine the smell

>>	Anonymous Wed Aug 24 23:14:27 2022 No.31601196 I hope Pomusuke gets paid for this. He's basically doing all the work.

>>	Anonymous Wed Aug 24 23:14:29 2022 No.31601198 OH HELL YEAH CHONKERS ON THE TELLY

>>	Anonymous Wed Aug 24 23:14:54 2022 No.31601222 >>31601163 I do too... I had to pause it because I got confused.

>>	Anonymous Wed Aug 24 23:14:57 2022 No.31601229 ENHANCE THE REFLECTION IN HIS EYES

>>	Anonymous Wed Aug 24 23:14:58 2022 No.31601230 I'm so happy

>>	Anonymous Wed Aug 24 23:15:00 2022 No.31601233 I'm now imagining Pomu chasing Pomusuke around the apartment trying to get him to calm down for the camera

>>	Anonymous Wed Aug 24 23:15:07 2022 No.31601242 chunky boy on the telly!!!

>>	Anonymous Wed Aug 24 23:15:11 2022 No.31601243 File: 388 KB, 700x687, 1629949676399.jpg [View same] [iqdb] [saucenao] [google] pure kino

>>	Anonymous Wed Aug 24 23:15:11 2022 No.31601244 File: 2.89 MB, 1920x1080, 1631859047053.png [View same] [iqdb] [saucenao] [google] ENHANCE

>>	Anonymous Wed Aug 24 23:15:19 2022 No.31601258 >>31600643 >Gee I wonder how. >Everyone else in corp vtubing had amazing numbers streaming it.

>>	Anonymous Wed Aug 24 23:15:20 2022 No.31601260 I'm still scared of him just reaching out and knocking over the camera

>>	Anonymous Wed Aug 24 23:15:25 2022 No.31601264 Pomusuke is BIG

>>	Anonymous Wed Aug 24 23:15:39 2022 No.31601277 Is that Pomuske???

>>	Anonymous Wed Aug 24 23:15:42 2022 No.31601281 >>31600805 Giwtwm Treating fit Vietcong women to a free meal for nothing in return? Goals.

>>	Anonymous Wed Aug 24 23:15:43 2022 No.31601283 I want to play with pomu's stinky hairy pussy

>>	Anonymous Wed Aug 24 23:15:44 2022 No.31601284 This inbred is so fucking fat. How many years does he have left?

>>	Anonymous Wed Aug 24 23:15:44 2022 No.31601285 does anyone still have that edit of sonny in the exmilitary album

>>	Anonymous Wed Aug 24 23:15:51 2022 No.31601293 What a fat cat. I want to squeeze it. Sorry Pomu but your cat is cuter.

>>	Anonymous Wed Aug 24 23:15:53 2022 No.31601297 File: 371 KB, 457x568, 1632965145952.png [View same] [iqdb] [saucenao] [google] what if pomusuke gets curious and knocks over the webcam...be careful pomu...

>>	Anonymous Wed Aug 24 23:16:00 2022 No.31601299 god i want to FUCK that cat, is this what white women feel when they see dogs??

>>	Anonymous Wed Aug 24 23:16:02 2022 No.31601300 >>31601258 >numberfags without numbers

>>	Anonymous Wed Aug 24 23:16:11 2022 No.31601309 Kiara is watching this and schlicking.

>>	Anonymous Wed Aug 24 23:16:13 2022 No.31601311 >>31601260 >pomusuke knocks the camera out of pomu's hand >for 3 frames we see her face clear as day >it's not her and is someone who looks completely different would be kinda kino

>>	Anonymous Wed Aug 24 23:16:15 2022 No.31601313 File: 337 KB, 1423x2048, FXXAWZAUcAA2AVo.jpg [View same] [iqdb] [saucenao] [google] how many anons are cat owners?

>>	Anonymous Wed Aug 24 23:16:24 2022 No.31601322 >>31601284 2 at most, pomu already talked about it

>>	Anonymous Wed Aug 24 23:16:36 2022 No.31601333 why the fuck did Pomu let her cat get this fat

>>	Anonymous Wed Aug 24 23:16:38 2022 No.31601338 i swear the longer I look at the cat the fatter it gets

>>	Anonymous Wed Aug 24 23:16:39 2022 No.31601341 File: 125 KB, 512x512, eoC2Yvv3DMPp8wSN5Z2wAQ.png [View same] [iqdb] [saucenao] [google] >>31601177 MM MMM MMMMMMMMMMMM

>>	Anonymous Wed Aug 24 23:16:44 2022 No.31601347 >>31601293 I also want to squeeze her hairy pussy

>>	Anonymous Wed Aug 24 23:16:52 2022 No.31601352 reflectionchads? are you on this?

>>	Anonymous Wed Aug 24 23:16:54 2022 No.31601354 >>31601087 I report so many number posts and other posts coming in turning around to shill Covershit and jack shit happens. It is selective moderation at best. Just accept that this board has the worst moderation on the site.

>>	Anonymous Wed Aug 24 23:16:58 2022 No.31601359 What a cute chonker. I love him. So round so fluffy

>>	Anonymous Wed Aug 24 23:17:02 2022 No.31601364 File: 474 KB, 844x486, 1654846785627.png [View same] [iqdb] [saucenao] [google] HAND

>>	Anonymous Wed Aug 24 23:17:03 2022 No.31601366 >>31601258 Even Lize, at the height of her popularity last year averaging 8-15k CCV only did like 3-4k for the mother series

>>	Anonymous Wed Aug 24 23:17:06 2022 No.31601370 File: 789 KB, 577x629, 1639541326419.png [View same] [iqdb] [saucenao] [google] >>31601313 I only own dogs

>>	Anonymous Wed Aug 24 23:17:11 2022 No.31601379 holy shit pomusuke is a fat fuck

>>	Anonymous Wed Aug 24 23:17:13 2022 No.31601383 >>31601284 >pomusuke is inbred >i'm inbred WE ARE

>>	Anonymous Wed Aug 24 23:17:13 2022 No.31601382 File: 47 KB, 720x709, 1648618743058.jpg [View same] [iqdb] [saucenao] [google] stop making your cats fat buy high quality cat food

>>	Anonymous Wed Aug 24 23:17:17 2022 No.31601384 >>31601311 it's going to be someone wearing a mito costume

>>	Anonymous Wed Aug 24 23:17:24 2022 No.31601391 >>31601277 No Pomu rented a cat, Pomusuke is just another level of opsec she does

>>	Anonymous Wed Aug 24 23:17:30 2022 No.31601396 >>31601354 >worst moderation on this site /v/ exists.

>>	Anonymous Wed Aug 24 23:17:32 2022 No.31601399 >pomu can't zoom out enough to get his full body on camera

>>	Anonymous Wed Aug 24 23:17:34 2022 No.31601407 >>31601313 Not me, I have 4 dogs and is a pain in the ass

>>	Anonymous Wed Aug 24 23:17:39 2022 No.31601414 architectbros whats our status

>>	Anonymous Wed Aug 24 23:17:43 2022 No.31601418 File: 11 KB, 100x100, 1649818504277.png [View same] [iqdb] [saucenao] [google] https://www.youtube.com/watch?v=2xHf2uKoAXY

>>	Anonymous Wed Aug 24 23:17:50 2022 No.31601429 File: 747 KB, 912x1200, natsu.png [View same] [iqdb] [saucenao] [google] Pomusuke and Natsu collab when?

>>	Anonymous Wed Aug 24 23:17:53 2022 No.31601435 This is a weird way to announce graduation.

>>	Anonymous Wed Aug 24 23:17:53 2022 No.31601434 >>31600977 Speak for yourself, that won't salvage anything. If she feels it doesn't work out for her in nijiEN she will graduate herself in a few months or so, sure.

>>	Anonymous Wed Aug 24 23:17:57 2022 No.31601439 >>31601165 Don't respond to bait. People got banned for posting ember because the OG pics posted of him WERE considered irl/dox because she's NEVER shown him off as Selen til his last bday.

>>	Anonymous Wed Aug 24 23:17:59 2022 No.31601443 File: 189 KB, 1057x1754, 1657279096453.jpg [View same] [iqdb] [saucenao] [google] This is the best stream in the history of nijisanji EN

>>	Anonymous Wed Aug 24 23:18:05 2022 No.31601449 File: 180 KB, 480x480, 20205210.png [View same] [iqdb] [saucenao] [google] HE'S SO FUCKING FAT AND STINKY I LOVE HIM

>>	Anonymous Wed Aug 24 23:18:10 2022 No.31601453 Pet the cat Pomu pet the fucking pet, pet it wtffff

>>	Anonymous Wed Aug 24 23:18:23 2022 No.31601464 >>31601313 Me, my cat will be 15 in October.

Anonymous Wed Aug 24 23:18:29 2022 No.31601475
File: 60 KB, 1280x733, 1661246900243.jpg [View same] [iqdb] [saucenao] [google]

I'm getting flashbacks to Mysta's first and only solo Twitter space where he played with his cats and you could hear them meow. Wish he'd do that again sometime. Of course, he doesn't live with his cats anymore...

>>	Anonymous Wed Aug 24 23:18:30 2022 No.31601476 >Pomu makes a lofi 24/7 channel with Pomusuke in the background Will you watch it?

>>	Anonymous Wed Aug 24 23:18:37 2022 No.31601485 >>31601382 at his stage of life it's probably better to keep him fat since he will lose weight quickly when he gets sick

>>	Anonymous Wed Aug 24 23:18:40 2022 No.31601488 >>31601382 Usually they get fat from free feeders that don’t want to feed the cat every 4 ish hours so they have food always available

>>	Anonymous Wed Aug 24 23:18:41 2022 No.31601490 File: 78 KB, 206x206, 1661383109928.png [View same] [iqdb] [saucenao] [google] >>31600883 None of them even retweeted anons doujin....

>>	Anonymous Wed Aug 24 23:18:41 2022 No.31601489 this was worth staying up for

>>	Anonymous Wed Aug 24 23:18:42 2022 No.31601494 >>31601354 every board is terrible, reporting does bare minimum and if it DOES do anything, it's to get you banned for "false reporting".

>>	Anonymous Wed Aug 24 23:18:48 2022 No.31601502 >>31601453 He'll probably get up and wander off if she tries petting him.

>>	Anonymous Wed Aug 24 23:18:52 2022 No.31601507 take your fatass cat on a walk you shitty pet owners

>>	Anonymous Wed Aug 24 23:19:12 2022 No.31601528 File: 242 KB, 1073x1013, 1657463273317.jpg [View same] [iqdb] [saucenao] [google] >>31601476 Who wouldn't?

>>	Anonymous Wed Aug 24 23:19:28 2022 No.31601549 Pomu got mad at every calling him fat so she defends his honor by calling him muscley

>>	Anonymous Wed Aug 24 23:19:38 2022 No.31601560 File: 2.13 MB, 480x584, 1649536294669.webm [View same] [iqdb] [saucenao] [google] >>31601414 >whats our status

>>	Anonymous Wed Aug 24 23:19:39 2022 No.31601563 my cat is cuter

>>	Anonymous Wed Aug 24 23:19:44 2022 No.31601568 >>31601476 Yes

Anonymous Wed Aug 24 23:19:44 2022 No.31601567

>>31600257

the nijiEN fanbase is unironically unaware of classic games, like others have said, lots of them are zoomers, if elira was nijiJP she easily would be breaking 2k or reaching 3k because the audience of JP ojisans who love their retro jpgs is huge over there (incluiding me)

>>	Anonymous Wed Aug 24 23:19:52 2022 No.31601579 I am sending this to that reddit that finds place's location even if it's just a tiny speck of light coming from the side. Time to find Pomu.

>>	Anonymous Wed Aug 24 23:19:54 2022 No.31601580 damn, pomusuke doesnt like to be filmed huh? He's always moving lmao

>>	Anonymous Wed Aug 24 23:20:00 2022 No.31601589 COME BACK YOU FAT FUCK

>>	Anonymous Wed Aug 24 23:20:01 2022 No.31601592 >>31601439 >Don't respond to bait >SEAhours >Ember pics deleted / banned >Cunny poster images never got deleted >the OceanLaw pic got deleted / banned really makes you think

>>	Anonymous Wed Aug 24 23:20:06 2022 No.31601603 come

>>	Anonymous Wed Aug 24 23:20:09 2022 No.31601606 >>31601507 I was a vet tech for years and seeing overweight cats makes me so mad

>>	Anonymous Wed Aug 24 23:20:25 2022 No.31601622 >>31601313 I got a bunch of free cats I found in a bush after their mama cat got hit by a car (mine)

>>	Anonymous Wed Aug 24 23:20:29 2022 No.31601628 >>31601258 Okay, give me the viewership for the average Earthbound stream compared to the vtubers average stream and include a minimum of four companies and all of it being EN.

>>	Anonymous Wed Aug 24 23:20:35 2022 No.31601632 File: 1.00 MB, 275x154, 40FDD87B-FDB1-414C-AA62-0F27287C54B0.gif [View same] [iqdb] [saucenao] [google] >>31601507 t. Never owned a cat

>>	Anonymous Wed Aug 24 23:20:36 2022 No.31601633 who here ship pomusuke x lucie

>>	Anonymous Wed Aug 24 23:20:38 2022 No.31601636 HE IS SO FUCKING FAT

>>	Anonymous Wed Aug 24 23:20:55 2022 No.31601655 >>31601439 I LITERALLY ONLY POSTED EMBER ON HIS BIRTHDAY THE EXACT SCREENSHOTS SELEN SHOWED AND STILL GOT BANNED fuck off with that you janny-lover go apply to be one if you wanna suck their cocks so much.

>>	Anonymous Wed Aug 24 23:21:00 2022 No.31601663 >>31601560 wtf is this real

>>	Anonymous Wed Aug 24 23:21:04 2022 No.31601668 File: 152 KB, 1131x1011, fluffy stinky.jpg [View same] [iqdb] [saucenao] [google] >>31601313 I have 3 cats and 3 dogs.

>>	Anonymous Wed Aug 24 23:21:08 2022 No.31601672 File: 599 KB, 1487x2048, 1643951808731.jpg [View same] [iqdb] [saucenao] [google] >>31601475 he never show us what tom looks like... only jerry... i was so sad

>>	Anonymous Wed Aug 24 23:21:09 2022 No.31601674 File: 207 KB, 500x500, 1630620529082.png [View same] [iqdb] [saucenao] [google] Oh god here it coooomes the pain is starting!

>>	Anonymous Wed Aug 24 23:21:14 2022 No.31601678 I just imagine Pomu running around with a camera tripod and chasing Pomusuke.

>>	Anonymous Wed Aug 24 23:21:20 2022 No.31601686 >>31601313 I have a pug, but I love cats too

>>	Anonymous Wed Aug 24 23:21:38 2022 No.31601705 File: 641 KB, 543x815, 1649426257899.png [View same] [iqdb] [saucenao] [google] >>31601603

>>	Anonymous Wed Aug 24 23:21:45 2022 No.31601713 >>31601678 cute

>>	Anonymous Wed Aug 24 23:21:46 2022 No.31601714 >>31601434 I hope she graduates before the nect wave

>>	Anonymous Wed Aug 24 23:22:03 2022 No.31601727 Wonder what pomu thinks about pink cat lmao

>>	Anonymous Wed Aug 24 23:22:04 2022 No.31601729 >>31601678 yes, thats literally what shes doing lmao why do you think it goes black? cause shes chasing him around her apartment

>>	Anonymous Wed Aug 24 23:22:10 2022 No.31601741 Pomusuke HATES being recorded!

>>	Anonymous Wed Aug 24 23:22:13 2022 No.31601744 File: 25 KB, 500x538, 1661127220294415.jpg [View same] [iqdb] [saucenao] [google] >Finana and Elira are getting mogged by Aia WTF is going on?

Anonymous Wed Aug 24 23:22:23 2022 No.31601753
File: 2.60 MB, 2160x3056, FQr1TCbaAAoZVMQ.jpg [View same] [iqdb] [saucenao] [google]

>>31601313
My cat is everything to me, I will make sure she has the happiest life possible. This stream is making me so happy, I fully smiled for the first time today. I want to kiss that cute little fluffy forehead. I hope Pomusuke gets a nice treat for working so hard for the audience today.

>>	Anonymous Wed Aug 24 23:22:31 2022 No.31601763 >>31601678 Pomu is so cute

>>	Anonymous Wed Aug 24 23:22:37 2022 No.31601769 Pomusuke is back to eating

>>	Anonymous Wed Aug 24 23:22:38 2022 No.31601771 Pomu walking around with the camera like that in tight conditions seems like an recipe for disaster

>>	Anonymous Wed Aug 24 23:22:38 2022 No.31601770 >>31601560 That cat needs correction.

>>	Anonymous Wed Aug 24 23:22:40 2022 No.31601772 Pomu's playing with her pussy in stream now? Can this branch get any more desperate for views.

>>	Anonymous Wed Aug 24 23:22:47 2022 No.31601783 I hope Pomusuke vomits on stream and you hear Pomu's >oh come the fuck on in the background

>>	Anonymous Wed Aug 24 23:22:52 2022 No.31601789 Pomu is running around her apartment! And she is naked!

>>	Anonymous Wed Aug 24 23:22:58 2022 No.31601796 >>31601741 Frankly, i wish pomusuke would graduate already, why did he got hired if he doesn't even want to stream.

>>	Anonymous Wed Aug 24 23:23:06 2022 No.31601809 >>31601396 /v/ is constantly POUNDED with shit that you need ten mods 24/7 to make it slightly presentable. /v/ still manages to be better than /vt/ in regards of moderation. They can't help people spam porn and /pol/ shit on it every few seconds.

>>	Anonymous Wed Aug 24 23:23:07 2022 No.31601810 File: 481 KB, 1000x800, 1642910683093.gif [View same] [iqdb] [saucenao] [google] >>31601678 I'm glad she's like this

>>	Anonymous Wed Aug 24 23:23:20 2022 No.31601823 I really, REALLY hate people who make having a fat pet some kind of funny thing. I haven't even had a pet for years now but for some reason calling an obese pet a "chonker" fucking infuriates me.

>>	Anonymous Wed Aug 24 23:23:36 2022 No.31601840 >>31601580 that's just cats

>>	Anonymous Wed Aug 24 23:23:37 2022 No.31601843 >>31601744 Aia playing a buff game Elira playing a debuff game Finana playing a fotm game after millie and elira already played it

>>	Anonymous Wed Aug 24 23:23:43 2022 No.31601859 File: 1.69 MB, 4512x6016, 1661383409847.jpg [View same] [iqdb] [saucenao] [google] >>31601313 Stinky 12 y/o man

>>	Anonymous Wed Aug 24 23:23:44 2022 No.31601858 >>31601434 >she will graduate herself in a few months or so, sure HELL YEAH BROTHER

>>	Anonymous Wed Aug 24 23:23:50 2022 No.31601865 File: 628 KB, 530x732, 1638065557166.png [View same] [iqdb] [saucenao] [google] >>31601313 I used to have a cat until a few months ago...I miss watching Pomu streams with her.

>>	Anonymous Wed Aug 24 23:23:54 2022 No.31601873 File: 186 KB, 480x480, 1660311841159381.png [View same] [iqdb] [saucenao] [google] >>31601705 Cute loli

>>	Anonymous Wed Aug 24 23:23:58 2022 No.31601876 >>31601823 I think it's hilarious. It's all the joy of making fun of fat people with none of the social repercussions

>>	Anonymous Wed Aug 24 23:23:59 2022 No.31601877 >>31601796 Still more streams this month that the nijiEN official channel, fucking lazy bitches

>>	Anonymous Wed Aug 24 23:24:00 2022 No.31601878 >>31601313 I have three cats. They are everything to me and I will unironically probably an hero once the last one is dead.

>>	Anonymous Wed Aug 24 23:24:02 2022 No.31601883 >Eating AGAIN fat fuck

>>	Anonymous Wed Aug 24 23:24:03 2022 No.31601885 What are the chances to get approval for this she instead recorded Pomusuke previously to avoid him doing something to doxx her?

>>	Anonymous Wed Aug 24 23:24:08 2022 No.31601890 I hope Pomu don't accidentally dox her shadow

>>	Anonymous Wed Aug 24 23:24:10 2022 No.31601892 >>31601313 Family used to own several. They died and no more cats for like 5 years. Now I play with my brother/neighbor's cat sometimes.

>>	Anonymous Wed Aug 24 23:24:27 2022 No.31601910 Your superchats go to this inbread fat cats food

>>	Anonymous Wed Aug 24 23:24:31 2022 No.31601912 >>31601313 I own both cats and dogs. They get along.

>>	Anonymous Wed Aug 24 23:24:38 2022 No.31601923 File: 23 KB, 529x309, REHQHmISSn.jpg [View same] [iqdb] [saucenao] [google] Look at this fat fuck, eating again, fat fuck

>>	Anonymous Wed Aug 24 23:24:46 2022 No.31601931 >>31601910 based

>>	Anonymous Wed Aug 24 23:24:58 2022 No.31601948 >>31601910 >inbread esl-chama...

>>	Anonymous Wed Aug 24 23:24:58 2022 No.31601950 >>31601885 what's he gonna do, say her fuckin name?

>>	Anonymous Wed Aug 24 23:25:00 2022 No.31601953 File: 3.15 MB, 1736x2456, 1661023264417029.png [View same] [iqdb] [saucenao] [google] Pomu's pussy is getting stuffed live on stream

>>	Anonymous Wed Aug 24 23:25:01 2022 No.31601956 File: 90 KB, 1109x621, 1632631051135.jpg [View same] [iqdb] [saucenao] [google] >>31601823 He's old as fuck already. Let him be fat.

>>	Anonymous Wed Aug 24 23:25:06 2022 No.31601964 File: 155 KB, 2048x1378, FXeqm6zagAAp-e3.jpg [View same] [iqdb] [saucenao] [google] >>31601859 he's so handsome

>>	Anonymous Wed Aug 24 23:25:14 2022 No.31601970 STOP EATING YOU FAT FUCK

>>	Anonymous Wed Aug 24 23:25:16 2022 No.31601972 >pomusuke is stinky >i am stinky >pomusuke is fat >i'm fat WE ARE

>>	Anonymous Wed Aug 24 23:25:24 2022 No.31601976 >>31601923 Pomu likes them fat! Like Selen.

>>	Anonymous Wed Aug 24 23:25:25 2022 No.31601980 File: 113 KB, 587x425, 1632877618119.png [View same] [iqdb] [saucenao] [google] >>31601674

>>	Anonymous Wed Aug 24 23:25:32 2022 No.31601987 >>31601910 Pomusuke probably eats more than Pomu. I can relate as a pet owner.

>>	Anonymous Wed Aug 24 23:25:35 2022 No.31601992 >>31601953 WHERE ARE HER NIPPLES

>>	Anonymous Wed Aug 24 23:25:39 2022 No.31601998 Pomu is an architect and that's the only reason why she hangs out with Selen.

>>	Anonymous Wed Aug 24 23:25:41 2022 No.31602003 File: 326 KB, 490x530, aia184.png [View same] [iqdb] [saucenao] [google] >>31601744 Don't shitpost with my oshi, go back

Anonymous Wed Aug 24 23:25:41 2022 No.31602002
File: 61 KB, 1000x1022, 1638151797589.jpg [View same] [iqdb] [saucenao] [google]

>>31601672
His mom could always send him a picture of Tom to post, but even with a reminder I doubt he'd remember to post it what with his ADHD zoomzoom brain.
Besides, he's always been open about the fact that he prefers dogs. He should get a cute little pet for his new place. It'd help alleviate his loneliness a bit.

>>	Anonymous Wed Aug 24 23:25:42 2022 No.31602004 >>31601972 in vast need of a shower and a diet

>>	Anonymous Wed Aug 24 23:25:46 2022 No.31602011 >>31601439 >til his last bday People itt were literally posting the birthday pic from Selen's Twitter and it was deleted, jannies and meidos are threadwatchers that don't watch the streams or follow any Niji on Twitter, that's just a fact

>>	Anonymous Wed Aug 24 23:25:56 2022 No.31602019 File: 55 KB, 800x450, inbread.jpg [View same] [iqdb] [saucenao] [google] >>31601948 ???

>>	Anonymous Wed Aug 24 23:26:02 2022 No.31602025 >>31601313 I wanted to, but my dad was allergic and my mom hated pets. And by the time I moved into my own place, I developed my dad's same allergies too.

>>	Anonymous Wed Aug 24 23:26:04 2022 No.31602028 >>31601592 Yeah there is a sensitive Dragoon janny. Probably why the threads have slown down because regular posters keep on netting bans over frivolous things that most /nijien/ posters don't bother anymore or are banned.

>>	Anonymous Wed Aug 24 23:26:16 2022 No.31602042 File: 108 KB, 1170x1113, 1635578516764.jpg [View same] [iqdb] [saucenao] [google] >>31601972 Pomu likes fat and stinky beings

>>	Anonymous Wed Aug 24 23:26:21 2022 No.31602052 File: 2.77 MB, 1920x1080, 1634393167120.webm [View same] [iqdb] [saucenao] [google] >>31601313 I have 1 cat. I feel bad sometimes that she has no frens but I dont want 2 cats. Rest of family are dog people.

>>	Anonymous Wed Aug 24 23:26:24 2022 No.31602056 >>31601948 Did I fucking stutter? He got a whole loaf in him

>>	Anonymous Wed Aug 24 23:26:29 2022 No.31602062 >>31601998 BASED

>>	Anonymous Wed Aug 24 23:26:34 2022 No.31602066 File: 57 KB, 480x480, 1642822345485.png [View same] [iqdb] [saucenao] [google] >>31602004 dont say it out loud...

>>	Anonymous Wed Aug 24 23:26:51 2022 No.31602081 STILL EATING

>>	Anonymous Wed Aug 24 23:26:57 2022 No.31602086 >>31601843 Elira also got worse views than Millie iirc

>>	Anonymous Wed Aug 24 23:27:00 2022 No.31602091 >>31602052 I have one of these wheels. My cat loves it.

>>	Anonymous Wed Aug 24 23:27:05 2022 No.31602098 File: 24 KB, 538x343, QQNrIOvsIV.jpg [View same] [iqdb] [saucenao] [google] AGAIN?

>>	Anonymous Wed Aug 24 23:27:05 2022 No.31602097 Pomu! You're feeding him more?? He's too fat already!!

>>	Anonymous Wed Aug 24 23:27:10 2022 No.31602102 This song sounds like a song you would hear in the morning living room scene in a VN

>>	Anonymous Wed Aug 24 23:27:16 2022 No.31602110 >>31602052 How expensive are those wheels

>>	Anonymous Wed Aug 24 23:27:33 2022 No.31602130 File: 176 KB, 1148x1600, FWRmVNhUEAA0vk8.jpg [View same] [iqdb] [saucenao] [google] I love my daughterwife! Three and a half hours left!!!!

>>	Anonymous Wed Aug 24 23:27:58 2022 No.31602156 he's itching he has fleas!!!

>>	Anonymous Wed Aug 24 23:28:21 2022 No.31602178 >>31602102 I was thinking the exact same thing

>>	Anonymous Wed Aug 24 23:28:22 2022 No.31602180 >everyone calling pomusuke obese >but he WILLINGLY goes back to the food after like 4 minutes HE'S JUST LIKE YOU ANONS!

>>	Anonymous Wed Aug 24 23:28:26 2022 No.31602185 I NEED TO BE MORE FAT SO POMU LIKES ME

>>	Anonymous Wed Aug 24 23:28:31 2022 No.31602191 POMU STUFFING POMUSUKE FOR THANKGIVING DINNER LET'S GOOOOOO

>>	Anonymous Wed Aug 24 23:28:36 2022 No.31602201 >>31602098 heckin chonker

>>	Anonymous Wed Aug 24 23:28:38 2022 No.31602206 File: 1.13 MB, 1000x1000, 1643637230515.gif [View same] [iqdb] [saucenao] [google] >>31602042 I'M IN LETS GOOOO

>>	Anonymous Wed Aug 24 23:28:53 2022 No.31602221 Pomu's planning to eat Pomuske

>>	Anonymous Wed Aug 24 23:28:55 2022 No.31602227 File: 323 KB, 1564x2048, FRw-ng7aMAAr5yV.jpg [View same] [iqdb] [saucenao] [google] >>31601475 I was so sad when he said they didn't live with him anymore... but at least they mist be having a good time with Mama Rias

>>	Anonymous Wed Aug 24 23:29:02 2022 No.31602232 it's not fat it's just winter fur

>>	Anonymous Wed Aug 24 23:29:03 2022 No.31602233 File: 262 KB, 1514x2400, 1654711512744.png [View same] [iqdb] [saucenao] [google] Pomusuke is just liek Pomu...

>>	Anonymous Wed Aug 24 23:29:06 2022 No.31602236 File: 79 KB, 480x480, 1630908190701.png [View same] [iqdb] [saucenao] [google] >>31602156 >Pomu's pussy has fleas Naaaasty

>>	Anonymous Wed Aug 24 23:29:18 2022 No.31602248 at least it seems to be wet food and not dry

>>	Anonymous Wed Aug 24 23:29:22 2022 No.31602254 >>31602221 shes japanese anon, not chinese.

>>	Anonymous Wed Aug 24 23:29:34 2022 No.31602261 File: 2.95 MB, 306x502, 1641080558135.gif [View same] [iqdb] [saucenao] [google] >fatass cat just rests after eating just so it can have the energy to eat some more

>>	Anonymous Wed Aug 24 23:29:35 2022 No.31602262 >>31601313 I've been thinking about getting one but knowing it won't live that long just seems depressing to me.

>>	Anonymous Wed Aug 24 23:29:36 2022 No.31602264 File: 328 KB, 400x430, 1659209115917503.png [View same] [iqdb] [saucenao] [google] >>31601843 >Pomu just streams her cat eating food >Mogs all 3 of them combined What in an actual fuck

>>	Anonymous Wed Aug 24 23:29:41 2022 No.31602272 >>31602232 in summer holy cope pomu

>>	Anonymous Wed Aug 24 23:29:42 2022 No.31602273 >>31601434 >Joined Nijisanji to earn money >Probably earns less than 200 CCV indies thanks to YT and corpo cut Won’t be surprised if she’s the first to graduate desu

>>	Anonymous Wed Aug 24 23:29:51 2022 No.31602280 >>31602110 NTA around $100 in Canada might be cheaper in the US.

>>	Anonymous Wed Aug 24 23:30:08 2022 No.31602293 File: 351 KB, 535x394, 1661027912812124.png [View same] [iqdb] [saucenao] [google] I can't watch this anymore. Pet streams make me think of all the ones I used to have that died. It's too painful. How do you guys do it?

>>	Anonymous Wed Aug 24 23:30:08 2022 No.31602292 >eats >relaxes this fucking fat cat living better than me

>>	Anonymous Wed Aug 24 23:30:11 2022 No.31602297 >>31602248 hopefully he's on OM because jesas he's fat

>>	Anonymous Wed Aug 24 23:30:21 2022 No.31602306 >>31601114 Maybe EN should have a VTA and maybe VTA should be more than a glorified acting class

>>	Anonymous Wed Aug 24 23:30:22 2022 No.31602308 File: 61 KB, 459x58, 1682430718.png [View same] [iqdb] [saucenao] [google] A C C E L E R A T E

>>	Anonymous Wed Aug 24 23:30:22 2022 No.31602310 File: 357 KB, 1273x1272, 1651004241904.jpg [View same] [iqdb] [saucenao] [google] >>31602261 I am starting to feel like Pomusuke has a better life than me...

>>	Anonymous Wed Aug 24 23:30:23 2022 No.31602312 >all this talk about Pomusuke being fat as fuck >Nobody talking about the fact that Pomu clipped his tail

>>	Anonymous Wed Aug 24 23:30:23 2022 No.31602313 Pomu's putting Pomusuke down tomorrow. This is /ourguy/'s last day.

>>	Anonymous Wed Aug 24 23:30:28 2022 No.31602317 >>31601434 uhh isn't the contract 2 years?

>>	Anonymous Wed Aug 24 23:30:47 2022 No.31602336 why is his tail so short

>>	Anonymous Wed Aug 24 23:30:51 2022 No.31602343 >am I about to get fucked up? >stream dies

>>	Anonymous Wed Aug 24 23:30:59 2022 No.31602346 Elira...

>>	Anonymous Wed Aug 24 23:31:01 2022 No.31602348 >>31602312 >>>>/r/eddit

>>	Anonymous Wed Aug 24 23:31:06 2022 No.31602351 >>31602264 Pomu always gets good numbers and created some intrigue with the title and odd thumbnail

>>	Anonymous Wed Aug 24 23:31:07 2022 No.31602354 >>31602272 P-Pomu is South American

>>	Anonymous Wed Aug 24 23:31:19 2022 No.31602367 >>31602336 she cut it shorter

>>	Anonymous Wed Aug 24 23:31:22 2022 No.31602368 Maybe Pomusuke has been Pomu all along

>>	Anonymous Wed Aug 24 23:31:24 2022 No.31602370 >>31602312 Pomusuke is a adopted

>>	Anonymous Wed Aug 24 23:31:24 2022 No.31602373 >>31602313 >Pomusuke is about to die >I'm about to die WE ARE

>>	Anonymous Wed Aug 24 23:31:25 2022 No.31602375 >>31602312 I hope it's because she got him like that

>>	Anonymous Wed Aug 24 23:31:29 2022 No.31602379 >>31602336 He lost it saving the world in an adventure with little Timmy

>>	Anonymous Wed Aug 24 23:31:33 2022 No.31602381 >>31602312 Pomu's cats are all pitty rescues. She grabs the mangiest, sorriest cats from the shelter. 99% chance that tail was lost in a medical incident or from his previous owners.

>>	Anonymous Wed Aug 24 23:31:42 2022 No.31602386 File: 2.71 MB, 640x494, 1636898824761.gif [View same] [iqdb] [saucenao] [google] >>31602221 She's planning to taxidermy him, why do you think she did the Pomudachi plushie as experiment first?

>>	Anonymous Wed Aug 24 23:31:43 2022 No.31602387 >>31602264 Power of the Pussy baby.

>>	Anonymous Wed Aug 24 23:31:51 2022 No.31602397 >>31602312 if they found him it's possible it's from an injury, pretty common in strays

>>	Anonymous Wed Aug 24 23:31:53 2022 No.31602400 >>31601865 I'm sorry for your loss anon

Anonymous Wed Aug 24 23:31:53 2022 No.31602401

>>31602317
Anon you don't know how contracts work.
The contract wouldn't be 'quit within 2 years and you lost all the money you made' it would be 'quit within 2 years and you can't apply for another company or we sue you'.
You can't stop someone from quitting their job. That's illegal.

>>	Anonymous Wed Aug 24 23:32:05 2022 No.31602414 Remember when Pomu talked the other day about Pomusuke almost killing her when he seated on her face while she was sleeping?

>>	Anonymous Wed Aug 24 23:32:09 2022 No.31602420 >>31602312 Pomu saved the cat anon, it was already like that probably

>>	Anonymous Wed Aug 24 23:32:16 2022 No.31602430 File: 3 KB, 252x59, z3.png [View same] [iqdb] [saucenao] [google] >>31602336 born that way

>>	Anonymous Wed Aug 24 23:32:17 2022 No.31602431 Why is Millie doing a TAG stream this early in the morning for those people?

>>	Anonymous Wed Aug 24 23:32:20 2022 No.31602432 File: 12 KB, 504x70, HrBkUqyqSz.jpg [View same] [iqdb] [saucenao] [google] Pomu stop reading this thread

>>	Anonymous Wed Aug 24 23:32:27 2022 No.31602436 >>31602312 pomu is /here/????

>>	Anonymous Wed Aug 24 23:32:30 2022 No.31602441 >>31602414 >the other day anon.... that was months ago

>>	Anonymous Wed Aug 24 23:32:31 2022 No.31602445 File: 8 KB, 353x74, pommers.png [View same] [iqdb] [saucenao] [google] Pomu in chat!

>>	Anonymous Wed Aug 24 23:32:35 2022 No.31602447 File: 255 KB, 680x976, 32d.png [View same] [iqdb] [saucenao] [google] >>31602373 Going to LIVE

>>	Anonymous Wed Aug 24 23:32:39 2022 No.31602452 >>31602312 Pomu Rainpuff 【NIJISANJI EN】 he was born with his tail btw Pomu Rainpuff 【NIJISANJI EN】 i mean, this is his natural tail lol. he didn't lose it or anything Pomu Rainpuff 【NIJISANJI EN】 yea he's olddd

>>	Anonymous Wed Aug 24 23:32:43 2022 No.31602456 >>31602381 >Pomu is a saviorfag

>>	Anonymous Wed Aug 24 23:32:55 2022 No.31602463 >>31602293 I really miss my cat whenever Pomu talks about Pomusuke but I continue watching for her because she seems genuinely happy to talk about him.

>>	Anonymous Wed Aug 24 23:32:58 2022 No.31602464 >>31602432 Does her chat point that out too?

>>	Anonymous Wed Aug 24 23:33:18 2022 No.31602486 POMU STOP READING THE THREAD

>>	Anonymous Wed Aug 24 23:33:29 2022 No.31602498 >>31602441 she talked about it recently

>>	Anonymous Wed Aug 24 23:33:31 2022 No.31602499 >>31602381 so if I dress myself up as a cat, your saying... theres a chance?

>>	Anonymous Wed Aug 24 23:33:35 2022 No.31602502 >>31601476 Obviously

>>	Anonymous Wed Aug 24 23:33:36 2022 No.31602503 >>31602456 Everyone should be with pets

>>	Anonymous Wed Aug 24 23:33:52 2022 No.31602517 File: 243 KB, 432x432, 1656175677167.png [View same] [iqdb] [saucenao] [google] pomu i'm really happy thank you for this stream

Anonymous Wed Aug 24 23:34:04 2022 No.31602528
File: 40 KB, 820x820, 1656028958248.jpg [View same] [iqdb] [saucenao] [google]

>check nijimado
>see Pomu's "mystery stream"
>it's the worst fucking BGM I've heard in my life
>but the cat is cute
I MISS MY CATSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS

>>	Anonymous Wed Aug 24 23:34:09 2022 No.31602534 >>31602312 Well, he was not named Pomusuke before Pomu joined NijiEN, he was probably named Bustinsuke or something, he transitioned into Pomusuke when she joined, so they had to cut his tail, it's what they do when you transition

>>	Anonymous Wed Aug 24 23:34:10 2022 No.31602535 >>31601177 you get your wisdom teeth taken out?

>>	Anonymous Wed Aug 24 23:34:15 2022 No.31602540 >>31602003 your oshi is shit

>>	Anonymous Wed Aug 24 23:34:18 2022 No.31602544 >>31602086 Nah Millie had a peak of 2.5k Elira was 3.2k

>>	Anonymous Wed Aug 24 23:34:25 2022 No.31602551 File: 1.03 MB, 1158x1637, FN4x6gQVcAQvM3n.jpg [View same] [iqdb] [saucenao] [google] >>31602130 SOON!!!!! I AM SO EXCITED!!!!

>>	Anonymous Wed Aug 24 23:34:27 2022 No.31602555 File: 1.41 MB, 640x485, 1653342425919.gif [View same] [iqdb] [saucenao] [google] >>31602381 >Pomu is a saviorfag >I desperately need saving I guess I'll just become a cat then

>>	Anonymous Wed Aug 24 23:34:39 2022 No.31602565 File: 387 KB, 1390x543, 1657577030836.png [View same] [iqdb] [saucenao] [google] Lazy boi living the dream

>>	Anonymous Wed Aug 24 23:34:45 2022 No.31602570 >>31602441 I'm nta but ever since this hobby consumed my life, my sense of time has been completely warped. I just realized last night that one of my favorite streams from "the other day" was actually in April while I was looking for it.

>>	Anonymous Wed Aug 24 23:34:55 2022 No.31602579 >>31602528 What you don't like VN BGM #263156?

>>	Anonymous Wed Aug 24 23:34:59 2022 No.31602591 >>31602264 La creatividad stream atm

>>	Anonymous Wed Aug 24 23:35:04 2022 No.31602593 File: 2.99 MB, 1920x1080, file.png [View same] [iqdb] [saucenao] [google] The way he sits his paws baaaaw hecking CUTE

>>	Anonymous Wed Aug 24 23:35:05 2022 No.31602594 File: 72 KB, 480x480, 1654373759737.png [View same] [iqdb] [saucenao] [google] My anxiety was so bad today that I even got feverish. Thanks for this stream, Pom.

>>	Anonymous Wed Aug 24 23:35:32 2022 No.31602615 fun fact: siamese cats' fur color changes depending on temperature. when my friend's cat got fixed the fur they shaved grew back in a perfect rectangle paler than the rest of the fur at first, it was funny. they also get darker in winter.

>>	Anonymous Wed Aug 24 23:35:40 2022 No.31602630 Imagine just getting to laze around on Pomu's floor all day, eating free food and watching her stream.

>>	Anonymous Wed Aug 24 23:35:46 2022 No.31602635 >>31602565 this fat feline bastard guy gets to hump Pomu's leg at night and basically? you're a fucking idiot Find out how by clicking here

>>	Anonymous Wed Aug 24 23:36:07 2022 No.31602651 Pomu is so cute and kind with animals, I think she is friends with the vtuber that saves cats

>>	Anonymous Wed Aug 24 23:36:18 2022 No.31602658 would you be pomuske if you could

>>	Anonymous Wed Aug 24 23:36:34 2022 No.31602669 >>31602615 this doesn't happen with my OSH. I wonder if he just isn't siamese enough.

>>	Anonymous Wed Aug 24 23:36:40 2022 No.31602673 Pomu's stream is being received in large bursts every couple seconds with a buffer while the others are a continuous download at slower speed, what does that mean? They're all set for ultra low latency.

>>	Anonymous Wed Aug 24 23:36:42 2022 No.31602675 HE'S SO FUCKING FAAAAAAAAAAAAAAT

>>	Anonymous Wed Aug 24 23:36:47 2022 No.31602679 Elira shilling Oliver's 3D

>>	Anonymous Wed Aug 24 23:36:53 2022 No.31602686 Pomusuke is not moving...

>>	Anonymous Wed Aug 24 23:37:01 2022 No.31602693 File: 282 KB, 270x458, 1657422579376.png [View same] [iqdb] [saucenao] [google] >>31602630 Sleeping with her too...

>>	Anonymous Wed Aug 24 23:37:10 2022 No.31602699 How is this Pomu stream getting 2.3k viewers?

>>	Anonymous Wed Aug 24 23:37:17 2022 No.31602705 >>31602456 Pomu was the Aia saviorfag anon itt all along…

>>	Anonymous Wed Aug 24 23:37:18 2022 No.31602708 >>31602675 yo momma's so fat, we call her pomuske

>>	Anonymous Wed Aug 24 23:37:38 2022 No.31602731 >>31602293 please rember hapi day

>>	Anonymous Wed Aug 24 23:37:41 2022 No.31602734 >>31602658 Yes, but he probably suffered a lot in his life, this last years are his reward until he is dead

>>	Anonymous Wed Aug 24 23:37:41 2022 No.31602735 >>31602658 Pros: >Get kicked by Pomu Cons: >None The answer is clear

>>	Anonymous Wed Aug 24 23:37:42 2022 No.31602738 Come Pomusuke

>>	Anonymous Wed Aug 24 23:37:43 2022 No.31602739 >>31602565 shit this handcam cooking stream is about to get wild

>>	Anonymous Wed Aug 24 23:37:49 2022 No.31602747 >>31602699 Kind of low for her doing something with camera.

>>	Anonymous Wed Aug 24 23:37:53 2022 No.31602751 >>31602699 She's Pomu

Anonymous Wed Aug 24 23:37:55 2022 No.31602754
File: 142 KB, 274x232, 1655520509951.png [View same] [iqdb] [saucenao] [google]

>>31601809
Anon, /v/'s jannies and mods are actual pajeets that don't know shit about vidyagames and can't even speak English. I saw a Blue Reflection thread getting purged to /h/ once, this was one of the most retarded things that I ever saw on this site

>>	Anonymous Wed Aug 24 23:37:58 2022 No.31602758 File: 10 KB, 1440x2560, AMOLEDtest.png [View same] [iqdb] [saucenao] [google] >>31602699 this is how

>>	Anonymous Wed Aug 24 23:38:00 2022 No.31602760 >>31602699 Power of fat cat doing fucking nothing.

>>	Anonymous Wed Aug 24 23:38:00 2022 No.31602759 >>31602699 slow day or CCVCOVID

>>	Anonymous Wed Aug 24 23:38:02 2022 No.31602762 >>31602699 Shut the fuck up >How is a stream getting X viewers? THERE'S THAT MANY PEOPLE WATCHING IT

>>	Anonymous Wed Aug 24 23:38:09 2022 No.31602767 Sometimes I feel like I could have been a better pet owner. I should have taken my dog to the park more.

>>	Anonymous Wed Aug 24 23:38:12 2022 No.31602772 >>31602273 >first to graduate Oh that honor is gonna go to Finana for sure. We know it, she knows it. It's only a matter of time of now.

>>	Anonymous Wed Aug 24 23:38:15 2022 No.31602775 File: 65 KB, 605x992, 1571110748921.jpg [View same] [iqdb] [saucenao] [google] >>31602669 >>31602615 For me, it's the orange one the best type of cat in the world

>>	Anonymous Wed Aug 24 23:38:20 2022 No.31602781 ENTER

>>	Anonymous Wed Aug 24 23:38:21 2022 No.31602784 She's petting him I'm going to cry

>>	Anonymous Wed Aug 24 23:38:46 2022 No.31602811 File: 254 KB, 1170x1461, 1657905772075.jpg [View same] [iqdb] [saucenao] [google] >>31602262 dont cats usually live longer than dogs though? I saw a video with a 30 year old cat

>>	Anonymous Wed Aug 24 23:38:47 2022 No.31602814 File: 379 KB, 1424x1424, 1641062774655.jpg [View same] [iqdb] [saucenao] [google] SO CUTE

>>	Anonymous Wed Aug 24 23:38:48 2022 No.31602813 How is stream getting views?

>>	Anonymous Wed Aug 24 23:38:56 2022 No.31602821 >>31602767 I feel it... But mine is too old to walk for 5 minutes now

>>	Anonymous Wed Aug 24 23:38:57 2022 No.31602823 >>31602699 I actually think this is low, if the stream was named pomusuke livecam she would have double the viewers

>>	Anonymous Wed Aug 24 23:38:58 2022 No.31602824 Pomu's shadow!!!!!

>>	Anonymous Wed Aug 24 23:39:12 2022 No.31602842 she's playing with her pussy

>>	Anonymous Wed Aug 24 23:39:19 2022 No.31602851 >>31602775 My vet always says orange cats are the nicest

>>	Anonymous Wed Aug 24 23:39:38 2022 No.31602872 HE IS EATING AGAIN

>>	Anonymous Wed Aug 24 23:39:49 2022 No.31602880 >>31602699 That's low. Not impressive.

>>	Anonymous Wed Aug 24 23:39:51 2022 No.31602882 >>31602811 yes 30 is rare though

>>	Anonymous Wed Aug 24 23:39:51 2022 No.31602883 >>31601998 JUST SPAT OUT MY DRINK ANON FUCK YOU

>>	Anonymous Wed Aug 24 23:39:54 2022 No.31602888 chunky baby

>>	Anonymous Wed Aug 24 23:39:55 2022 No.31602891 >fat fuck eating again

>>	Anonymous Wed Aug 24 23:39:59 2022 No.31602897 >>31602759 >>31602758 >>31602823 >numberfag post >get 1 billion replies you idiots. You see a numberfag you tell them to leave. That simple

>>	Anonymous Wed Aug 24 23:40:08 2022 No.31602902 File: 18 KB, 515x313, j7r5wReHdi.jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Wed Aug 24 23:40:11 2022 No.31602909 File: 856 KB, 898x1270, 1661034271795146.png [View same] [iqdb] [saucenao] [google] >Pomu REALLY wants to own a lizard again >Can't because she keeps adopting mistreated cats to take care of them Why is she so great

>>	Anonymous Wed Aug 24 23:40:11 2022 No.31602910 Jesus Christ... Her hand is small compared to the chonk bastard...

>>	Anonymous Wed Aug 24 23:40:28 2022 No.31602928 >>31601771 We've seen plenty, she's not worried.

>>	Anonymous Wed Aug 24 23:40:36 2022 No.31602937 File: 149 KB, 1078x1079, 1539758441722.jpg [View same] [iqdb] [saucenao] [google] >>31602851 he's damn right

>>	Anonymous Wed Aug 24 23:40:45 2022 No.31602944 Is this why she likes Garfield so much?

>>	Anonymous Wed Aug 24 23:41:02 2022 No.31602955 He's eating AGAIN!!! Pomuske, you have to stop!!

>>	Anonymous Wed Aug 24 23:41:08 2022 No.31602961 >>31602262 Cats can pretty easily live to 20 if they live indoors

>>	Anonymous Wed Aug 24 23:41:15 2022 No.31602969 >>31602842 >Slender fairy alone at home playing with her pussy LIVE

>>	Anonymous Wed Aug 24 23:41:19 2022 No.31602971 File: 172 KB, 512x512, 1643822975025.png [View same] [iqdb] [saucenao] [google] >>31602937 Look at their tails... It's a heart!

>>	Anonymous Wed Aug 24 23:41:25 2022 No.31602975 >>31602262 If you do get a cat then PLEASE don't let it go outdoors. So many cats go missing and get run over or starve to death because some dickhead owner thinks it's unfair to keep them in a house or apartment.

>>	Anonymous Wed Aug 24 23:41:38 2022 No.31602989 I really wish we could hear Pomu while she was petting Pomusuke. You just know she was calling him a stinky old fat fuck in a loving way

>>	Anonymous Wed Aug 24 23:41:46 2022 No.31602995 Pomusuke... there's no more food... you ate it all...

>>	Anonymous Wed Aug 24 23:41:59 2022 No.31603005 File: 131 KB, 227x222, 1655674106663.png [View same] [iqdb] [saucenao] [google] Goodnight anons, I'm going to sleep for couple of hours before Petra's outfit reveal. Hope you'll enjoy the current streams

>>	Anonymous Wed Aug 24 23:42:00 2022 No.31603006 File: 234 KB, 314x399, 1638448245398.png [View same] [iqdb] [saucenao] [google] >>31602937 >Cats finding the love of their lives >I don't

>>	Anonymous Wed Aug 24 23:42:03 2022 No.31603010 >>31602775 i have an old tuxedo who's chilling by the balcony door while pomusuke's on the tv, i have a little sailor fuku collar i put on him sometimes

>>	Anonymous Wed Aug 24 23:42:12 2022 No.31603020 >>31601771 She's wearing leggings and gloves there's nothing to see unless she randomly falls over.

>>	Anonymous Wed Aug 24 23:42:15 2022 No.31603026 >>31602851 reddit says they are the dumbest cats (r/oneorangebraincell) don't judge me, cats are the only reason I go on reddit

>>	Anonymous Wed Aug 24 23:42:15 2022 No.31603025 I kinda want a cat now

>>	Anonymous Wed Aug 24 23:42:18 2022 No.31603029 >>31602937 Me and who?

>>	Anonymous Wed Aug 24 23:42:18 2022 No.31603030 File: 7 KB, 360x50, nn.png [View same] [iqdb] [saucenao] [google]

>>	Anonymous Wed Aug 24 23:42:21 2022 No.31603032 >>31602909 POV: Pomu just got done jerking off Pomusuke because he doesnt have a mate to relieve his sexual tension

>>	Anonymous Wed Aug 24 23:42:27 2022 No.31603039 >>31602975 THIS

>>	Anonymous Wed Aug 24 23:42:44 2022 No.31603065 >>31603006 >find the love of your life >its a vtuber sad days

>>	Anonymous Wed Aug 24 23:42:46 2022 No.31603068 I can't believe pomusuke got his 3D debut before Selen. MANAGEMENT HATE !

>>	Anonymous Wed Aug 24 23:42:47 2022 No.31603069 >Pomu Rainpuff 【NIJISANJI EN】 omg he came Sorry, that was me

>>	Anonymous Wed Aug 24 23:42:48 2022 No.31603070 >>31603030 >come

>>	Anonymous Wed Aug 24 23:43:28 2022 No.31603099 File: 198 KB, 300x360, 1633601750206.png [View same] [iqdb] [saucenao] [google] >>31603030 >omg he came Pomu... don't tell me you...

>>	Anonymous Wed Aug 24 23:43:28 2022 No.31603102 File: 250 KB, 389x391, 1633761475842.png [View same] [iqdb] [saucenao] [google] >>31601285

>>	Anonymous Wed Aug 24 23:43:32 2022 No.31603103 If you're archiving the stream, make sure to grab the chat as well since her comments are basically half the experience here.

>>	Anonymous Wed Aug 24 23:43:33 2022 No.31603104 >>31603032 he's neutered

>>	Anonymous Wed Aug 24 23:43:38 2022 No.31603109 This fat fuck just sleeps next to his bowl waiting for food

>>	Anonymous Wed Aug 24 23:43:43 2022 No.31603115 And that Pomuske? Sonny my man.

>>	Anonymous Wed Aug 24 23:43:44 2022 No.31603117 File: 87 KB, 200x182, 1655788928662.png [View same] [iqdb] [saucenao] [google] >>31603069 >>31603070 >>31603030

>>	Anonymous Wed Aug 24 23:43:57 2022 No.31603134 File: 93 KB, 728x1024, 1652545375090.jpg [View same] [iqdb] [saucenao] [google] >>31603006 I wish any woman loved me as much as they love cats. It's not fair why wasn't I born a small furry animal that is innately endearing to everyone.

>>	Anonymous Wed Aug 24 23:44:13 2022 No.31603143 File: 815 KB, 1051x939, 1639834272660.jpg [View same] [iqdb] [saucenao] [google] >>31603065 Pain...

>>	Anonymous Wed Aug 24 23:44:36 2022 No.31603173 Pomu petting Pomuske!!!

>>	Anonymous Wed Aug 24 23:44:40 2022 No.31603177 File: 711 KB, 1176x832, Horny Finana.jpg [View same] [iqdb] [saucenao] [google] >>31603030 Pomusuke came on and laid Pomu!

>>	Anonymous Wed Aug 24 23:44:42 2022 No.31603180 >>31603104 and? My foreskin is gone but I still jerk it 24/7

>>	Anonymous Wed Aug 24 23:44:46 2022 No.31603183 >>31603103 does nijichatninja not archive privated streams' chat?

>>	Anonymous Wed Aug 24 23:44:51 2022 No.31603186 File: 110 KB, 640x480, 94585269f2856686e7cd68048bde3d121494846050_full.jpg [View same] [iqdb] [saucenao] [google] >>31603065 >Animal falls in love with animal girl Many such cases.

>>	Anonymous Wed Aug 24 23:44:54 2022 No.31603187 >>31603099 >Selen relieves herself with Ember >Pomu relieves herself with Pomusuke >Elira relieves herself with her little brother

>>	Anonymous Wed Aug 24 23:45:00 2022 No.31603197 File: 81 KB, 500x500, 1658240777075.png [View same] [iqdb] [saucenao] [google] >Selen has an unplanned stream in 3 hours N-no......

>>	Anonymous Wed Aug 24 23:45:02 2022 No.31603203 >>31603134 Buy a cat and go walk with it outside on a leash. Best way to get a gf guaranteed.

>>	Anonymous Wed Aug 24 23:45:09 2022 No.31603208 It's over...

>>	Anonymous Wed Aug 24 23:45:13 2022 No.31603211 >Pomudachis getting sadboy over a cat Get it together you fucks

>>	Anonymous Wed Aug 24 23:45:15 2022 No.31603212 I miss Pomusuke.....

>>	Anonymous Wed Aug 24 23:45:19 2022 No.31603216 I wonder if Pomu ever did the prank of farting in front of his nose

>>	Anonymous Wed Aug 24 23:45:21 2022 No.31603219 Exit Pomusuke...

>>	Anonymous Wed Aug 24 23:45:27 2022 No.31603227 gonna cry, I want to see more of pomusuke

>>	Anonymous Wed Aug 24 23:45:33 2022 No.31603232 I miss him already

>>	Anonymous Wed Aug 24 23:45:35 2022 No.31603237 AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAH I MISS POMUSUKE

>>	Anonymous Wed Aug 24 23:45:36 2022 No.31603239 hope yawl are happy with your 30 minutes of fatcat

>>	Anonymous Wed Aug 24 23:45:51 2022 No.31603255 File: 162 KB, 585x564, tiredpomu.png [View same] [iqdb] [saucenao] [google] AAAAAAAAAAAAAAAAAAAAAAAAH I MISS POMUSUKE POMUSUKE POMUSUKE POMUSUKE AAAAAAAAAAAAAAAAAH POMUSUKEEEEEEEEEEEEEEEEEE

>>	Anonymous Wed Aug 24 23:46:00 2022 No.31603265 >over already wtf she couldve milked this for hours

>>	Anonymous Wed Aug 24 23:46:01 2022 No.31603266 >>31603239 yes i am thanks pomu

>>	Anonymous Wed Aug 24 23:46:02 2022 No.31603268 >>31603180 Nigga, that's not the same, they cut his testicles

>>	Anonymous Wed Aug 24 23:46:03 2022 No.31603271 Pomusuke for wave 7 PLS NOOOOOORRRR

>>	Anonymous Wed Aug 24 23:46:05 2022 No.31603274 Now what

>>	Anonymous Wed Aug 24 23:46:06 2022 No.31603276 >>31603197 It’s a Petra watch along

>>	Anonymous Wed Aug 24 23:46:09 2022 No.31603279 >>31603203 >walking a cat on a leash in public that's retarded anon I'm not letting some dumb fuck's dog attack my cat

>>	Anonymous Wed Aug 24 23:46:13 2022 No.31603283 File: 70 KB, 173x259, 1629898548223.png [View same] [iqdb] [saucenao] [google] I miss Pomusuke...

>>	Anonymous Wed Aug 24 23:46:16 2022 No.31603287 >>31603239 Better than metal wolf

>>	Anonymous Wed Aug 24 23:46:21 2022 No.31603292 >>31603180 anon... for the sake of the public education system of whatever country you're from, i hope you're ESL

>>	Anonymous Wed Aug 24 23:46:24 2022 No.31603296 >>31603102 thank you so much i love you anon please kiss me

>>	Anonymous Wed Aug 24 23:46:34 2022 No.31603302 >>31603276 Based

>>	Anonymous Wed Aug 24 23:46:46 2022 No.31603313 >>31603180 cats are not like dog, you can't jerk them off on the other hand I have heard of people rubbing their female cat's pussy with a q-tip to help with the heat

>>	Anonymous Wed Aug 24 23:46:53 2022 No.31603319 File: 970 KB, 1203x1744, 124346.png [View same] [iqdb] [saucenao] [google] >>31603276 >Petra has such low CCV that even her genmates have to do "watchalong" streams to try and boost it poor pengi...

Anonymous Wed Aug 24 23:46:54 2022 No.31603324
File: 444 KB, 1280x1280, DAQIqheUwAAQpIU.jpg [View same] [iqdb] [saucenao] [google]

>>31603186
What many don't know is that Grape-kun got to meet the VA of his waifu.
This is the equivalent of Pomudachi meeting Pomu and being held in her arms.

THIS PENGUIN FOUND LOVE AND DIED HAPPY.

>>	Anonymous Wed Aug 24 23:46:55 2022 No.31603326 File: 524 KB, 770x528, 1647747430771.png [View same] [iqdb] [saucenao] [google] What is life without Pomusuke?

>>	Anonymous Wed Aug 24 23:46:56 2022 No.31603330 >>31603296 chu

>>	Anonymous Wed Aug 24 23:47:11 2022 No.31603344 After this it will be so much more devastating if Pomusuke leave us...

>>	Anonymous Wed Aug 24 23:47:23 2022 No.31603351 >>31603239 do you think you'll do it again in the future?

>>	Anonymous Wed Aug 24 23:48:01 2022 No.31603395 >>31603239 He's a good chonker

>>	Anonymous Wed Aug 24 23:48:08 2022 No.31603400 >>31603239 >yawl Sure thing Pomu

>>	Anonymous Wed Aug 24 23:48:31 2022 No.31603422 >>31603187 relieving themselves makes me think they're pissing not orgasming

>>	Anonymous Wed Aug 24 23:48:33 2022 No.31603426 >>31603313 >I have heard of people rubbing their female cat's pussy with a q-tip to help with the heat haha... what the fuck?

>>	Anonymous Wed Aug 24 23:48:38 2022 No.31603436 >>31603239 very very. thank you

>>	Anonymous Wed Aug 24 23:48:40 2022 No.31603439 >>31603239 thanks for showing us your fat hairy pussy

>>	Anonymous Wed Aug 24 23:48:42 2022 No.31603442 so is this just another menhera episode?

>>	Anonymous Wed Aug 24 23:48:44 2022 No.31603443 A day without Pomuske stream is lethargic syndrome

>>	Anonymous Wed Aug 24 23:48:45 2022 No.31603445 File: 58 KB, 1280x720, 1647916659953.jpg [View same] [iqdb] [saucenao] [google] >>31603239 Thank you Pomu

>>	Anonymous Wed Aug 24 23:48:51 2022 No.31603453 >>31603239 Thank you Pomu I love you and I think is really cute that you protect and save animals

>>	Anonymous Wed Aug 24 23:48:53 2022 No.31603457 File: 112 KB, 1080x1546, 1643123618536325.jpg [View same] [iqdb] [saucenao] [google] I love Aia https://www.youtube.com/watch?v=UHQ8jY2oZlY

>>	Anonymous Wed Aug 24 23:49:04 2022 No.31603470 >>31603197 Does she really?

>>	Anonymous Wed Aug 24 23:49:14 2022 No.31603481 File: 133 KB, 1201x1075, 1652303847860.jpg [View same] [iqdb] [saucenao] [google] I miss Pomu...she didn't even talk and I'm still suffering withdrawals already.

>>	Anonymous Wed Aug 24 23:49:16 2022 No.31603488 File: 84 KB, 177x232, 1651561821682.png [View same] [iqdb] [saucenao] [google] >>31603324 It's not the same...

>>	Anonymous Wed Aug 24 23:49:36 2022 No.31603511 File: 198 KB, 290x293, 1633625396945.png [View same] [iqdb] [saucenao] [google] >>31603470 idk, i just made it up for (You)'s

>>	Anonymous Wed Aug 24 23:49:48 2022 No.31603524 File: 2.87 MB, 1000x1000, 1643924551858.gif [View same] [iqdb] [saucenao] [google] >>31603239 Make it 60 minutes next time

>>	Anonymous Wed Aug 24 23:49:53 2022 No.31603530 >>31603324 VA and vtubing are not the same.

>>	Anonymous Wed Aug 24 23:49:55 2022 No.31603531 I'm Pomusuke

>>	Anonymous Wed Aug 24 23:50:15 2022 No.31603557 >>31603426 it's a thing just google it, I don't recommend it though you might really hurt her

>>	Anonymous Wed Aug 24 23:50:20 2022 No.31603564 >>31603511 Fucking Pentomo. I’ll rape correct your ass

>>	Anonymous Wed Aug 24 23:50:21 2022 No.31603565 >>31603457 She looks better without her glasses, but her face is still way too flat and featureless.

>>	Anonymous Wed Aug 24 23:50:40 2022 No.31603589 File: 1.40 MB, 823x828, 1656687959436.png [View same] [iqdb] [saucenao] [google] >>31603511 If you want people to talk to you could just ask pentomo... no need to lie and make things up.

>>	Anonymous Wed Aug 24 23:50:55 2022 No.31603601 File: 505 KB, 294x432, 1634859932073.gif [View same] [iqdb] [saucenao] [google] >Pomu was reading the thread instead of her chat

>>	Anonymous Wed Aug 24 23:51:02 2022 No.31603606 >>31603565 but... fat tits

>>	Anonymous Wed Aug 24 23:51:21 2022 No.31603627 Dumb shit like this unironically brightens my mood more than most streams. Like that time a few months ago when Pomu did her "endurance till im to tired" shitpost. That made my day probably more than if she had done a regular stream

>>	Anonymous Wed Aug 24 23:51:41 2022 No.31603638 >>31603606 proof?

>>	Anonymous Wed Aug 24 23:51:45 2022 No.31603646 File: 1.21 MB, 1000x1000, 1660059710906.png [View same] [iqdb] [saucenao] [google] What the fuck, why didn't anyone tell me Scarle was doing RFA? https://www.youtube.com/watch?v=2EYEHKUhfw0

>>	Anonymous Wed Aug 24 23:51:47 2022 No.31603650 >>31603324 pomies, you're not a cute animal

>>	Anonymous Wed Aug 24 23:51:51 2022 No.31603655 Waiting room: https://www.youtube.com/watch?v=3y9omwU-wPc https://www.youtube.com/watch?v=3y9omwU-wPc https://www.youtube.com/watch?v=3y9omwU-wPc

>>	Anonymous Wed Aug 24 23:51:52 2022 No.31603658 >>31603557 can i use my penis instead of a q-tip?

>>	Anonymous Wed Aug 24 23:52:23 2022 No.31603686 >>31603601 Has Pomu's chibi always the hairclip? Am I crazy?

>>	Anonymous Wed Aug 24 23:52:25 2022 No.31603689 >>31603655 I fucking love millie, this will be awesome

>>	Anonymous Wed Aug 24 23:52:39 2022 No.31603698 File: 337 KB, 529x523, 1661028316880457.png [View same] [iqdb] [saucenao] [google] https://youtu.be/G8zUpqFPp2Q?t=4396 Pomusuke... Why would Pomu do this to someone so cute?

>>	Anonymous Wed Aug 24 23:52:42 2022 No.31603703 File: 65 KB, 1170x1390, 1654572422016.jpg [View same] [iqdb] [saucenao] [google] >>31603426 >>31603557 >>31603658 kill yourselves

>>	Anonymous Wed Aug 24 23:52:46 2022 No.31603707 File: 333 KB, 1177x1630, 1631652490250.jpg [View same] [iqdb] [saucenao] [google] >NO MORE FLIPPERS

>>	Anonymous Wed Aug 24 23:52:50 2022 No.31603712 >>31603658 micro penis anon...

>>	Anonymous Wed Aug 24 23:52:51 2022 No.31603714 File: 646 KB, 400x300, 1632310423326.gif [View same] [iqdb] [saucenao] [google] I hope Pomu never graduates

>>	Anonymous Wed Aug 24 23:52:52 2022 No.31603716 File: 848 KB, 976x549, 1637307692426.png [View same] [iqdb] [saucenao] [google] >>31603324

>>	Anonymous Wed Aug 24 23:52:53 2022 No.31603719 File: 413 KB, 1448x1448, 1659830171457926.jpg [View same] [iqdb] [saucenao] [google] >>31603239 would you be open to doing this again later?

>>	Anonymous Wed Aug 24 23:53:03 2022 No.31603731 >>31603658 hello shane dawson

>>	Anonymous Wed Aug 24 23:53:25 2022 No.31603752 File: 156 KB, 1170x2532, FNr6lwGWYBAyTqd.jpg [View same] [iqdb] [saucenao] [google] Which of the boys are good at cooking?

>>	Anonymous Wed Aug 24 23:53:33 2022 No.31603757 >>31603686 Always had*

>>	Anonymous Wed Aug 24 23:53:35 2022 No.31603759 >>31603703 I refuse to get lectured by an aloucreep, go back to crushing dogs or whatever you do

>>	Anonymous Wed Aug 24 23:53:38 2022 No.31603764 >>31603565 I like her design, but it does remind me of Pokemon.

>>	Anonymous Wed Aug 24 23:53:39 2022 No.31603766 File: 3.81 MB, 400x300, 1642855718016.gif [View same] [iqdb] [saucenao] [google] >>31603686 Yes, but she's looking into a mirror in that screenshot, so it's on the other side of her head

>>	Anonymous Wed Aug 24 23:53:40 2022 No.31603767 >>31603719 >Still no Necromantic cover

>>	Anonymous Wed Aug 24 23:53:54 2022 No.31603774 >>31603752 mysta

>>	Anonymous Wed Aug 24 23:54:15 2022 No.31603789 >>31603655 If this isn't an english stream doesn't matter.

>>	Anonymous Wed Aug 24 23:54:19 2022 No.31603791 >>31603752 vox vacuma

>>	Anonymous Wed Aug 24 23:54:20 2022 No.31603792 >>31603752 Alban

>>	Anonymous Wed Aug 24 23:54:34 2022 No.31603800 >>31603714 Sooner or later she will be gone, but I hope she sticks around in some way or another

>>	Anonymous Wed Aug 24 23:55:05 2022 No.31603833 >>31603655 >Adobo Neat.

>>	Anonymous Wed Aug 24 23:55:31 2022 No.31603866 >>31603766 Oh wow, that really is why it looked different.

>>	Anonymous Wed Aug 24 23:55:37 2022 No.31603876 File: 360 KB, 512x512, 1660812889377127.png [View same] [iqdb] [saucenao] [google] >>31603789 It is an English stream

>>	Anonymous Wed Aug 24 23:55:40 2022 No.31603879 File: 1.10 MB, 2896x4096, 1661026324208210.jpg [View same] [iqdb] [saucenao] [google] https://youtu.be/QxZXPQSs5RY?t=11819 I can't believe Rosemi did this! Truly devilish

>>	Anonymous Wed Aug 24 23:55:42 2022 No.31603883 >>31603698 Pomu the animal abuser...I can fix her...

>>	Anonymous Wed Aug 24 23:55:43 2022 No.31603887 @me when Rosemi-sama guerillas

>>	Anonymous Wed Aug 24 23:55:44 2022 No.31603889 File: 389 KB, 1500x789, 1630574624750.jpg [View same] [iqdb] [saucenao] [google] >>31603638

>>	Anonymous Wed Aug 24 23:56:03 2022 No.31603908 I want pomu to doki doki my waku waku

>>	Anonymous Wed Aug 24 23:56:18 2022 No.31603925 >>31603752 Vox Alban Sonny and Shu?

>>	Anonymous Wed Aug 24 23:56:35 2022 No.31603945 >>31603655 >tagalog No thanks.

>>	Anonymous Wed Aug 24 23:56:41 2022 No.31603950 I think Enna should drive over to Millie's place and cook with her

>>	Anonymous Wed Aug 24 23:56:54 2022 No.31603968 File: 411 KB, 1500x1122, 1639273495559.jpg [View same] [iqdb] [saucenao] [google] >>31603638

>>	Anonymous Wed Aug 24 23:56:54 2022 No.31603967 File: 480 KB, 2454x3093, 1638154185997.jpg [View same] [iqdb] [saucenao] [google] The cutest fairy

>>	Anonymous Wed Aug 24 23:57:04 2022 No.31603976 >>31603889 Must…breed….

>>	Anonymous Wed Aug 24 23:57:33 2022 No.31604004 sometimes the things elira says make me think she's wildly depressed or something

>>	Anonymous Wed Aug 24 23:57:38 2022 No.31604010 >>31603925 sonny literally said he was bad at cooking today

>>	Anonymous Wed Aug 24 23:57:45 2022 No.31604016 File: 3.67 MB, 640x504, 1638441900497.gif [View same] [iqdb] [saucenao] [google] gm taichou

>>	Anonymous Wed Aug 24 23:57:59 2022 No.31604039 >>31603968 I swear this image is the only reason people ever liked her

>>	Anonymous Wed Aug 24 23:58:02 2022 No.31604043 File: 301 KB, 714x675, 1658826425022071.png [View same] [iqdb] [saucenao] [google] Reminder that after Petra we have to wait TWO DAYS for Rosemi and FIVE DAYS for Selen

>>	Anonymous Wed Aug 24 23:58:16 2022 No.31604057 >>31603879 she really is satan...

>>	Anonymous Wed Aug 24 23:58:22 2022 No.31604059 POMU'S HAIRY SILVER SIAMESE PUSSY

>>	Anonymous Wed Aug 24 23:58:26 2022 No.31604065 >>31604004 She’s a hikkineet. There is no question about it

>>	Anonymous Wed Aug 24 23:58:29 2022 No.31604069 >elira and petra up all night messaging each other cute

>>	Anonymous Wed Aug 24 23:58:58 2022 No.31604096 File: 31 KB, 512x512, ppstinky.png [View same] [iqdb] [saucenao] [google] >>31603481 I feel the opposite, this stream did wonders to me. It was so sweet that I feel full of energy for the rest of the day. Pomusuke LOVE!

>>	Anonymous Wed Aug 24 23:59:05 2022 No.31604101 File: 104 KB, 400x430, 1661372250384715.png [View same] [iqdb] [saucenao] [google] GET YOUR ASSES IN HERE: https://www.youtube.com/watch?v=3y9omwU-wPc https://www.youtube.com/watch?v=3y9omwU-wPc https://www.youtube.com/watch?v=3y9omwU-wPc

>>	Anonymous Wed Aug 24 23:59:14 2022 No.31604106 >>31604065 hikkineets don't go on week long trips to florida with friends

>>	Anonymous Wed Aug 24 23:59:17 2022 No.31604110 File: 102 KB, 640x480, petora.jpg [View same] [iqdb] [saucenao] [google] >>31603716 Made this just for you

>>	Anonymous Wed Aug 24 23:59:23 2022 No.31604118 >>31604043 PETRA HATE

>>	Anonymous Wed Aug 24 23:59:34 2022 No.31604126 File: 786 KB, 1000x1000, dawosecollage.png [View same] [iqdb] [saucenao] [google] Ahem... SEX!!

>>	Anonymous Wed Aug 24 23:59:40 2022 No.31604135 >>31604010 He's a food snob. I think his food is fine for most people but he holds it to his standard hence he's "bad"

>>	Anonymous Wed Aug 24 23:59:43 2022 No.31604138 File: 82 KB, 768x768, 1661113124145573.jpg [View same] [iqdb] [saucenao] [google] I like Ms. Amare. But Aia's constant transitioning between them is kind of getting old. Maybe do one stream with each persona, but constantly switching is kind of ehh

>>	Anonymous Wed Aug 24 23:59:46 2022 No.31604146 In what stream, it was a long time ago, did Pomu accidentally leave her mic open when she went and petted Pomusuke and talked with him a bit. It was really cute and sweet and the first time Pomusuke was "on stream"

>>	Anonymous Wed Aug 24 23:59:58 2022 No.31604159 >>31604101 No cornbip no view

>>	Anonymous Thu Aug 25 00:00:16 2022 No.31604177 aia having more ccv than elira. what.

>>	Anonymous Thu Aug 25 00:00:21 2022 No.31604180 >>31604101 I don't speak fucking flip

>>	Anonymous Thu Aug 25 00:00:30 2022 No.31604189 >>31604069 >Elira and Petra >Pomu and Selen Finana... Rosemi...

>>	Anonymous Thu Aug 25 00:00:36 2022 No.31604193 >>31604043 who do we blame for this?

>>	Anonymous Thu Aug 25 00:00:46 2022 No.31604203 >>31604180 It's English

>>	Anonymous Thu Aug 25 00:00:47 2022 No.31604207 >>31604135 good point, he does frequently underestimate himself yes

>>	Anonymous Thu Aug 25 00:00:48 2022 No.31604208 >>31604101 i can't flip

>>	Anonymous Thu Aug 25 00:00:50 2022 No.31604214 File: 374 KB, 1748x2480, 1651785548901.jpg [View same] [iqdb] [saucenao] [google] My cult leader!

>>	Anonymous Thu Aug 25 00:00:57 2022 No.31604219 >>31604126 Alban made this post

>>	Anonymous Thu Aug 25 00:01:00 2022 No.31604222 >>31604177 Even I am not above mindlessly watching block game no matter who plays it

>>	Anonymous Thu Aug 25 00:01:07 2022 No.31604229 >>31604146 Tokyo Chronos, I think there's a timestamp for it in the comments

>>	Anonymous Thu Aug 25 00:01:25 2022 No.31604246 >>31604177 A 30 year old rpg that didn’t age well is viewer poison

>>	Anonymous Thu Aug 25 00:01:26 2022 No.31604247 >>31604189 Finana has aster

>>	Anonymous Thu Aug 25 00:01:33 2022 No.31604255 >SNES game shitting itself with too many sprites Yep.

>>	Anonymous Thu Aug 25 00:01:52 2022 No.31604277 >>31604135 >>31604207 His scallops pasta in mengen yesterday had me drooling...

>>	Anonymous Thu Aug 25 00:01:56 2022 No.31604284 >>31604247 Just like how she had Mysta, right? And Alban? We know how this goes, anon.

>>	Anonymous Thu Aug 25 00:01:59 2022 No.31604288 >>31604138 I agree, but I don't think she can keep that voice for a long time, maybe with some more voice training she can go for an entire stream, but I can still hear her voice cracking when she goes for too long.

>>	Anonymous Thu Aug 25 00:02:09 2022 No.31604296 >>31604146 >>31604229 https://www.youtube.com/watch?v=kL_Pw-wyy9c&t=8323s

>>	Anonymous Thu Aug 25 00:02:14 2022 No.31604301 >>31604193 Selen for hers, but I don't know why Rosemi would wait 2 days. Although we're getting her original song on the same day

>>	Anonymous Thu Aug 25 00:03:01 2022 No.31604357 What is that laugh..

>>	Anonymous Thu Aug 25 00:03:10 2022 No.31604360 >>31604246 >earthbound is 28 years old Holy fuck

>>	Anonymous Thu Aug 25 00:03:18 2022 No.31604367 >>31604277 his plate is very cool

>>	Anonymous Thu Aug 25 00:04:21 2022 No.31604431 >>31604301 Rosemi and Petra probably could have done theirs together as a relay, but having to wait a week for Selen's would be pretty bad optics.

>>	Anonymous Thu Aug 25 00:04:55 2022 No.31604463 >>31604301 rosemi's stalling for selen it'd be weird for them to debut theirs and wait 5 more days for selen

>>	Anonymous Thu Aug 25 00:05:02 2022 No.31604473 Millie will speak English in her Tagalog stream, but it will be in her sexy Flip accent

>>	Anonymous Thu Aug 25 00:05:07 2022 No.31604481 >>31604360 Don't let it set in...

>>	Anonymous Thu Aug 25 00:05:08 2022 No.31604483 >>31604431 Why is Selen waiting a week for hers

>>	Anonymous Thu Aug 25 00:05:49 2022 No.31604536 >Elira having trouble sleeping lately >Millie emo posting >Enna being sad and laughing off how miserable she is the besties

>>	Anonymous Thu Aug 25 00:06:00 2022 No.31604545 >>31604296 Soooooooo cuuuuuuuute

>>	Anonymous Thu Aug 25 00:06:02 2022 No.31604547 millie you're meant to fry the food not the webcam

>>	Anonymous Thu Aug 25 00:06:36 2022 No.31604583 >>31604284 she has her e-rp partner, me

>>	Anonymous Thu Aug 25 00:06:46 2022 No.31604590 >>31604483 If you believe dragoons, its because she has a project she is rushing to finish(working herself to death with those @'s) which she had planned for next month.

>>	Anonymous Thu Aug 25 00:06:52 2022 No.31604598 is it slow in here today or is it my adhd

>>	Anonymous Thu Aug 25 00:07:01 2022 No.31604610 >>31604536 Going to Montreal has that effect on people

>>	Anonymous Thu Aug 25 00:07:11 2022 No.31604615 >>31604483 She wanted to make it a whole spectacle

>>	Anonymous Thu Aug 25 00:07:25 2022 No.31604626 >>31604483 >Selen: HAHAHA My co-workers can debut their outfits together, just let me have 1 more month to prepare something for my Dragoons HAHAHA >Management: NOOOOOOOOOO BUT MUH UNITY AND MERCH, YOU HAVE TO DEBUT AS A WAVE

>>	Anonymous Thu Aug 25 00:07:27 2022 No.31604628 The lesbians mad at pogmu are so funny, especially because they think Pomu is a pure lesbian and not a bi girl

>>	Anonymous Thu Aug 25 00:07:33 2022 No.31604632 Millie's tagalog accent is like she's from the ghetto

>>	Anonymous Thu Aug 25 00:07:55 2022 No.31604658 >>31604598 It's been slow for a few weeks

>>	Anonymous Thu Aug 25 00:08:08 2022 No.31604668 >>31604632 that’s because she is

>>	Anonymous Thu Aug 25 00:08:09 2022 No.31604669 >>31604536 >meanwhile Wosemi was grooving it on fortnite yesterday

>>	Anonymous Thu Aug 25 00:08:12 2022 No.31604672 >>31604296 but pomu im loneling too I also want some love..

>>	Anonymous Thu Aug 25 00:08:13 2022 No.31604674 Cornbip is back!!

>>	Anonymous Thu Aug 25 00:08:43 2022 No.31604708 >>31604610 fucking queebs

>>	Anonymous Thu Aug 25 00:08:48 2022 No.31604711 >>31604483 some stupid ass project related to the outfit and trying to make it a spectacle when its just a fucking outfit

>>	Anonymous Thu Aug 25 00:08:55 2022 No.31604715 >>31603324 Reminder Hululu became a vtuber

>>	Anonymous Thu Aug 25 00:09:03 2022 No.31604722 >>31604669 She's the only one in her natural habitat of fr*gs in Montreal

>>	Anonymous Thu Aug 25 00:09:03 2022 No.31604721 >>31604632 for real? What's the difference?

>>	Anonymous Thu Aug 25 00:09:14 2022 No.31604734 >>31604658 why is that

>>	Anonymous Thu Aug 25 00:09:16 2022 No.31604739 File: 341 KB, 659x659, TrxfOORlDOTGLiytekYaI.png [View same] [iqdb] [saucenao] [google] after getting into nijien I asked my flip coworker to take me out for flip food I liked their karekare and sisig

>>	Anonymous Thu Aug 25 00:09:43 2022 No.31604769 >>31604658 i did randomly think /nijien/ was more tolerable these days. almost enjoyable even

>>	Anonymous Thu Aug 25 00:09:51 2022 No.31604775 File: 955 KB, 2897x4096, FVsAwjtVUAE2Db2.jpg [View same] [iqdb] [saucenao] [google] >>31604722 prag? palaka?

>>	Anonymous Thu Aug 25 00:10:01 2022 No.31604783 >>31604632 >like she's from the ghetto That's like the vast majority of flipland. One kinda modern SEA city, vast favelas and mudhuts everywhere else. Also that one island housing ISIS off-brand terrorists.

>>	Anonymous Thu Aug 25 00:10:03 2022 No.31604785 don’t search Petra in the archive right now

>>	Anonymous Thu Aug 25 00:10:35 2022 No.31604819 I have that same exact rice cooker... for when I cook in the office...

>>	Anonymous Thu Aug 25 00:10:35 2022 No.31604818 that's a really smol rice cooker, millie

>>	Anonymous Thu Aug 25 00:10:35 2022 No.31604817 >Luca attention whoring again

>>	Anonymous Thu Aug 25 00:10:53 2022 No.31604836 >>31604783 Lol is that Sulu?

>>	Anonymous Thu Aug 25 00:10:56 2022 No.31604842 >>31604483 selen is retarded, please understand

>>	Anonymous Thu Aug 25 00:11:04 2022 No.31604851 >>31604783 You mean Abu Sayaff? They already affliated themselves to ISIS though.

>>	Anonymous Thu Aug 25 00:11:04 2022 No.31604850 >>31604711 you don't get it man. HER outfit is WAAAAAAAAAAY more special and a bigger deal than any other outfit reveal in the branch.

>>	Anonymous Thu Aug 25 00:11:34 2022 No.31604872 File: 320 KB, 2048x1448, La Diabla.jpg [View same] [iqdb] [saucenao] [google] >>31604536 They spend two days with Rosemi and now are experiencing withdrawal. Satan is truly the master of temptation.

>>	Anonymous Thu Aug 25 00:11:40 2022 No.31604874 >>31604203 No it's not...........

>>	Anonymous Thu Aug 25 00:12:04 2022 No.31604897 >>31604817 that is kind of the job of a vtuber

>>	Anonymous Thu Aug 25 00:12:13 2022 No.31604906 >>31604628 what happened?

>>	Anonymous Thu Aug 25 00:12:18 2022 No.31604909 This is my first Millie flip stream... cute...

>>	Anonymous Thu Aug 25 00:12:25 2022 No.31604920 >>31604874 it's taglish

>>	Anonymous Thu Aug 25 00:12:49 2022 No.31604941 >>31604785 reminds me of that 50% of the time when I search my oshi's name in the archive it's always the /#/thread shittalking him, they really like to talk about nijien lol

>>	Anonymous Thu Aug 25 00:12:50 2022 No.31604942 >>31604874 Haha made you watch. But she spoke English in her sex accent earlier. And she will speak english from time to time

>>	Anonymous Thu Aug 25 00:12:52 2022 No.31604945 elira please stop running away if the wild encounters are beating the shit out of you then the boss will beat the shit out of you harder, thats why you beat the wild encounters to increase your level ewiwa plz

>>	Anonymous Thu Aug 25 00:12:59 2022 No.31604950 >>31604897 Only Luca does that, not even Selen best friend Pomu, does that

>>	Anonymous Thu Aug 25 00:13:15 2022 No.31604961 Ewiwa is a zoomer

>>	Anonymous Thu Aug 25 00:13:25 2022 No.31604972 File: 536 KB, 1536x2048, 1664167925951445.jpg [View same] [iqdb] [saucenao] [google] >>31604872 https://www.youtube.com/watch?v=eqfFxdtsl6E

>>	Anonymous Thu Aug 25 00:14:00 2022 No.31604995 File: 127 KB, 1242x1321, 1634464214072.jpg [View same] [iqdb] [saucenao] [google] >>31604785

>>	Anonymous Thu Aug 25 00:14:02 2022 No.31604996 >>31604906 They don't like hetero ships but think their yuri ships are real, dumb things don't worry

>>	Anonymous Thu Aug 25 00:14:14 2022 No.31605000 >>31604739 cute mystake

>>	Anonymous Thu Aug 25 00:14:27 2022 No.31605013 wtf is millie making

>>	Anonymous Thu Aug 25 00:14:46 2022 No.31605027 flip-bros, what is Millie saying? What is her accent like?

>>	Anonymous Thu Aug 25 00:14:59 2022 No.31605035 >>31605013 Chicken Adobo with eggs and pineapple. Staple Filipino food.

>>	Anonymous Thu Aug 25 00:15:05 2022 No.31605037 >>31604996 ships are dumb, planes are better, like the f22 raptor

>>	Anonymous Thu Aug 25 00:15:10 2022 No.31605045 >>31604817 you guys won't complain if fulgur, alban, ike and vox do this instead of luca.

Anonymous Thu Aug 25 00:15:15 2022 No.31605051
File: 268 KB, 1290x2000, Hanabatake_Chaika_-_Young_%28with_Spirit%29.jpg [View same] [iqdb] [saucenao] [google]

>>31604850
I just dont understand why the second one
like if she wanted a spectacle for the third one that would make sense because for the third outfit you need to commission it yourself and you can request whatever you want for it
like Chaika turning into a mech or having a shota model with a tree spirit behind him
for the third and on outfits you can go crazy with them

>>	Anonymous Thu Aug 25 00:15:20 2022 No.31605059 >>31604734 I unironically blame iluna

>>	Anonymous Thu Aug 25 00:16:05 2022 No.31605091 >>31605035 dang that looks good on google image

>>	Anonymous Thu Aug 25 00:16:05 2022 No.31605090 >>31605059 In that case, we need to accelerate far more.

>>	Anonymous Thu Aug 25 00:16:12 2022 No.31605097 >>31604734 it's axia's fault

>>	Anonymous Thu Aug 25 00:16:25 2022 No.31605107 File: 36 KB, 364x324, 1655233911104118.jpg [View same] [iqdb] [saucenao] [google] Watching chat's reaction to Millie is hilarious

>>	Anonymous Thu Aug 25 00:16:25 2022 No.31605108 >>31604734 Summer is ending, kids are back in school/uni

>>	Anonymous Thu Aug 25 00:16:25 2022 No.31605106 >>31605045 >you guys how are lucubs always the dumbest bait gobblers

Anonymous Thu Aug 25 00:17:02 2022 No.31605139

>>31604721
I'm a flip but her accent is really jarring for me. It's like a mix of Bisaya/trying to mimic flips who can't speak English well into her accent(this is popular with a lot of flips because it's "funny").

>>31604783
That's only really for the other regions, Luzon is pretty modern especially in the Greater Metro Manila region

>>	Anonymous Thu Aug 25 00:17:03 2022 No.31605140 >>31605097 No it’s Lauren’s

>>	Anonymous Thu Aug 25 00:17:20 2022 No.31605151 >>31605108 >kids If there really were THAT many children reading my hornyposts all this time I would be disturbed

>>	Anonymous Thu Aug 25 00:17:23 2022 No.31605156 >>31604626 Selen hate

Anonymous Thu Aug 25 00:17:29 2022 No.31605160

>>31605045
Yes i would because they disrupt the fucking stream and i complained when Fulgur joined the VC just to shill merch
Besides, those people write a few messages and then they fuck off or watch the stream in silence
Luca keeps annoying me with his constant attention whoring, it reminds me of iPN

>>	Anonymous Thu Aug 25 00:17:41 2022 No.31605179 >>31604734 pomuschizo got banned

Anonymous Thu Aug 25 00:17:50 2022 No.31605184

>>31605051
Yeah... I like Selen, but she's putting added pressure on herself to try and make it a spectacle. She's been complaining about being exhausted and needing to take naps again, but she's the one who put herself in that position and... idk. I'm grateful for her projects but this one, I just don't understand.

>>	Anonymous Thu Aug 25 00:18:01 2022 No.31605193 >>31605108 so you’re saying that when the kids go back to school the thread will become less slow?

>>	Anonymous Thu Aug 25 00:18:12 2022 No.31605203 File: 160 KB, 1050x840, 20220824_201740.jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Thu Aug 25 00:18:17 2022 No.31605209 File: 2.49 MB, 2258x1696, 1659226466142.png [View same] [iqdb] [saucenao] [google]

>>	Anonymous Thu Aug 25 00:18:50 2022 No.31605239 Millie's stream is like >gablegoobagabba -- ceo boyfriend -- gabbaboobamalamaka....

>>	Anonymous Thu Aug 25 00:18:56 2022 No.31605245 Why is Millie doing a Tagalog stream at 8 AM Philippines time?

Reply to thread

Name
E-mail
Subject
Comment
Action

Advanced search
Text to find
Subject [?]Search by post subject. Leave empty for any.
Username [?]Search for user name. Leave empty for any user name.
Tripcode [?]Search for tripcode. Leave empty for any.
Email [?]Search by email. Leave empty for any.
Filename [?]Search by image filename. Leave empty for any.
From Date [?]Enter what date to start searching from. Format is YYYY-MM-DD
To Date [?]Enter what date to start searching until. Format is YYYY-MM-DD
Image hash
Search in	All Posts OPs Only
Deleted posts	Show all posts Show only deleted posts Only show non-deleted posts
Internal posts	Show all posts Show only internal posts Show only archived posts
Order	New posts first Old posts first
Capcode	All Posts Only by Users Only by Mods Only by Admins Only by Developers
Results	Posts Threads
Action	[ Simple ]

/vt/ - Virtual Youtubers