/NijiEN/ Nijisanji EN General

File: 236 KB, 1448x2048, FW4uTaKVQAA5gK1.jpg [View same] [iqdb] [saucenao] [google]

/NijiEN/ Nijisanji EN General Anonymous Fri Jul 15 11:13:33 2022 No.28238266 [Reply] [Original]

Nijisanji EN Youtube channels:
https://www.youtube.com/channel/UC-JSeFfovhNsEhftt1WHMvg/channels

Twitter:
https://twitter.com/NIJISANJI_World
https://twitter.com/i/lists/1415262975435231235

Lazulight:
https://twitter.com/PomuRainpuff
https://twitter.com/EliraPendora
https://twitter.com/3W1W4 (alt)
https://twitter.com/FinanaRyugu
https://twitter.com/RyuguFinana (alt)

Obsydia:
https://twitter.com/Rosemi_Lovelock
https://twitter.com/Petra_Gurin
https://twitter.com/Selen_Tatsuki

Ethyria:
https://twitter.com/MillieParfait
https://twitter.com/EnnaAlouette
https://twitter.com/NinaKosaka
https://twitter.com/ReimuEndou

Luxiem:
https://twitter.com/Ike_Eveland
https://twitter.com/Mysta_Rias
https://twitter.com/Vox_Akuma
https://twitter.com/Luca_Kaneshiro
https://twitter.com/Shu_Yamino

Noctyx:
https://twitter.com/sonny_brisko
https://twitter.com/uki_violeta
https://twitter.com/alban_knox
https://twitter.com/fulgur_ovid
https://twitter.com/yugo_asuma

Teamup schedule for Nijisanji EN:
https://teamup.com/ks1mraas71v3fjf1c2
https://walfie.github.io/niji-en-pinned/
https://nijien.vercel.app/

To watch streams at the same time:
https://holodex.net/
https://pomuhub.com/
https://niji-mado.web.app/home
Open devtools (F12 key), go to console tab, input the following code, then refresh the page.
localStorage.setItem('rulePauseOther', 0);
You only need to do this once, or until your browser data is cleared.

NijiEN song playlist:
https://youtube.com/playlist?list=PLKN0vyOK8SHelderZX3Vb84zwoAWoTKwR
To loop indefinitely get a browser extension preventing Youtube autopause.

Nijisanji chat log:
https://niji.chats.ninja/#/comment

Aggie archive:
https://catbox.moe/c/hp31z6

Our Minecraft Server:
ninisani.moe

Reminder to ignore bait, shitposting, samefags, discordfags, numberfags, tribalfags and falseflaggers.

Previous thread: >>28233566

>>	Anonymous Fri Jul 15 11:14:09 2022 No.28238281 >>28238266 I just got into the stream I just wanna say Sukoya's voice is really hot

>>	Anonymous Fri Jul 15 11:14:17 2022 No.28238284 File: 951 KB, 2879x3928, 94561992-7E78-4561-A229-4AC7FAE66063.jpg [View same] [iqdb] [saucenao] [google] Luca love!

>>	Anonymous Fri Jul 15 11:14:22 2022 No.28238287 File: 491 KB, 2048x1281, 1631263120113.jpg [View same] [iqdb] [saucenao] [google] Sonny LOVE!

>>	Anonymous Fri Jul 15 11:14:23 2022 No.28238290 File: 533 KB, 1451x2048, FXmmLuDXwAEfZYV.jpg [View same] [iqdb] [saucenao] [google] Ike love!

>>	Anonymous Fri Jul 15 11:14:23 2022 No.28238289 File: 281 KB, 439x514, 1657857328793.png [View same] [iqdb] [saucenao] [google] SONNY LOVE MANIFEST HE STREAMS TF2 MORE

>>	Anonymous Fri Jul 15 11:14:23 2022 No.28238288 has sonny fucked sukoya yet

>>	Anonymous Fri Jul 15 11:14:24 2022 No.28238291 >>28238169 it's either that, a one night stand, or you also have to be a crossdresser for them to date you

>>	Anonymous Fri Jul 15 11:14:39 2022 No.28238303 File: 532 KB, 2160x2160, 1630766946036.jpg [View same] [iqdb] [saucenao] [google] <3

>>	Anonymous Fri Jul 15 11:14:48 2022 No.28238305 File: 363 KB, 1530x2048, FON0LyGakAYiMpz.jpg [View same] [iqdb] [saucenao] [google] Mysta love!

>>	Anonymous Fri Jul 15 11:14:55 2022 No.28238308 sonny more like bonny

>>	Anonymous Fri Jul 15 11:15:02 2022 No.28238312 >>28238288 he and Alban doubleteamed her

>>	Anonymous Fri Jul 15 11:15:04 2022 No.28238313 File: 225 KB, 1448x2048, FXYv8-5aMAcBfRF.jpg [View same] [iqdb] [saucenao] [google] >>28238305 Mysta love!

>>	Anonymous Fri Jul 15 11:15:25 2022 No.28238319 >>28238308 so true

>>	Anonymous Fri Jul 15 11:15:28 2022 No.28238320 >>28238288 he's too busy being pschotic and gay with alban

>>	Anonymous Fri Jul 15 11:15:36 2022 No.28238324 File: 303 KB, 506x496, 1657624496254.png [View same] [iqdb] [saucenao] [google] Vox (forma de koushien)

>>	Anonymous Fri Jul 15 11:15:48 2022 No.28238330 File: 140 KB, 1920x1080, D1751060-72B1-4DCD-AA4F-0726616FA32C.jpg [View same] [iqdb] [saucenao] [google] sonny love! (and i am manifesting for his next karaoke to happen soon)

>>	Anonymous Fri Jul 15 11:16:07 2022 No.28238339 File: 512 KB, 2048x1448, 460C7F98-B368-466D-AA14-4E3DF76CA687.jpg [View same] [iqdb] [saucenao] [google] I'm reading the thread even though I'm at work and getting depressed that I can't watch Mysta being cute...

>>	Anonymous Fri Jul 15 11:16:09 2022 No.28238340 >Kei_16GB Is this a pun or something?

>>	Anonymous Fri Jul 15 11:16:18 2022 No.28238345 Leos still keeps getting mad because his students keep going for studies instead of baseball. He looked at their grades and most of them are A so he made a joke that they're all aiming for Tokyo Uni or Cambridge

Anonymous Fri Jul 15 11:16:22 2022 No.28238347
File: 49 KB, 250x250, Petralove.png [View same] [iqdb] [saucenao] [google]

>>28238141
Don't give up Pomie. Just focus on yourself. The more you chase something the more it gets away from you. Just take care of yourself first. A relationship won't save you from being miserable.

>>	Anonymous Fri Jul 15 11:16:49 2022 No.28238362 File: 3.92 MB, 2896x4096, E89C4FCC-34D5-4402-99B0-A8ACAE40EB5A.jpg [View same] [iqdb] [saucenao] [google] P o n t o

>>	Anonymous Fri Jul 15 11:16:51 2022 No.28238361 File: 101 KB, 800x800, FBqu45RVUAUz3nf.png [View same] [iqdb] [saucenao] [google]

>>	Anonymous Fri Jul 15 11:16:55 2022 No.28238364 File: 607 KB, 2300x1400, FXY_kzeUYAUoSue.jpg [View same] [iqdb] [saucenao] [google] Alban love!!

Anonymous Fri Jul 15 11:17:01 2022 No.28238369
File: 448 KB, 1752x2048, IMG_20220712_113404.jpg [View same] [iqdb] [saucenao] [google]

>>28238169
i have had experience with cd's and youre right for the most part, i have had a one night stand with one and it felt great tho
>>28238128
i dont think i mind people who wants their oshi to be more successful because its a win-win situation for both the viewer and the liver but i dont like that it is the sole focus, i watch myamya because she's super adorable, i love her sketches in the niji shows too, she's funny. i dont look at subcounts myself

>>	Anonymous Fri Jul 15 11:17:20 2022 No.28238374 >>28238362 N

>>	Anonymous Fri Jul 15 11:17:25 2022 No.28238379 MAYUYU MURDER SPREE

>>	Anonymous Fri Jul 15 11:17:43 2022 No.28238390 >>28238339 It's time to become a NEET again, sis.

>>	Anonymous Fri Jul 15 11:17:44 2022 No.28238391 >>28238374 E

>>	Anonymous Fri Jul 15 11:18:11 2022 No.28238402 >sonny is crazy man

>>	Anonymous Fri Jul 15 11:18:16 2022 No.28238405 Sonny is crazy man

>>	Anonymous Fri Jul 15 11:18:18 2022 No.28238409 File: 1.01 MB, 1200x1600, d7abc13f9e3950196ecd7b17381e2261.jpg [View same] [iqdb] [saucenao] [google] >>28238374 E

>>	Anonymous Fri Jul 15 11:18:37 2022 No.28238420 was sukoya surprised that sonny is crazy?

>>	Anonymous Fri Jul 15 11:18:39 2022 No.28238421 >>28238390 I would if I could man, I really would

>>	Anonymous Fri Jul 15 11:18:44 2022 No.28238424 > sonny is a crazy man hes not lying

>>	Anonymous Fri Jul 15 11:18:52 2022 No.28238427 >>28238324 did they do nina ?

>>	Anonymous Fri Jul 15 11:18:57 2022 No.28238431 File: 643 KB, 2000x1241, FRXZSEmVEAAtQ5n.jpg [View same] [iqdb] [saucenao] [google] sonnyban LOVE! Nagao will now have ptsd whenever he sees Noctyx.

>>	Anonymous Fri Jul 15 11:18:59 2022 No.28238432 File: 417 KB, 1424x1906, 1635576178193.jpg [View same] [iqdb] [saucenao] [google] >Sonny is crazy man

>>	Anonymous Fri Jul 15 11:19:01 2022 No.28238435 >>28224393 >0 mods show up when niji males announced

>>	Anonymous Fri Jul 15 11:19:10 2022 No.28238439 >>28238409 GI!

>>	Anonymous Fri Jul 15 11:19:12 2022 No.28238441 >>28238339 Hang in there, the vod will be there. I was going to sleep and catch up on the vod, but I already fell asleep earlier while watching tf2 and woke up an hour before so eh...

>>	Anonymous Fri Jul 15 11:19:25 2022 No.28238449 File: 158 KB, 1000x1000, 1633813867217.jpg [View same] [iqdb] [saucenao] [google] Nina Love!

>>	Anonymous Fri Jul 15 11:19:56 2022 No.28238468 >>28238435 that meido was busy samefagging because he wanted a male split

>>	Anonymous Fri Jul 15 11:20:37 2022 No.28238485 a good recovery last game after that horrible game with horrible villains

>>	Anonymous Fri Jul 15 11:20:50 2022 No.28238492 File: 177 KB, 1934x2048, FXjS_MeaIAEVvqB.jpg [View same] [iqdb] [saucenao] [google] aikou love!

>>	Anonymous Fri Jul 15 11:20:58 2022 No.28238493 >>28238420 I mean, Sonny was laughing maniacally when he killed her with Alban

>>	Anonymous Fri Jul 15 11:21:18 2022 No.28238504 >>28238435 hololive was a mistake

>>	Anonymous Fri Jul 15 11:21:39 2022 No.28238517 File: 513 KB, 1964x2048, 1643963014331.jpg [View same] [iqdb] [saucenao] [google] >>28238431 I mean, he keeps saying he'll kill Yugo... Sonny and Alban just protecting their kyou--I mean, wavemate.

>>	Anonymous Fri Jul 15 11:21:47 2022 No.28238520 >>28238468 so, whats the verdict? will it be split or will they discuss it in the same general??

>>	Anonymous Fri Jul 15 11:21:57 2022 No.28238530 >>28238435 if you havent noticed the mods and jannies are all biased faggots

>>	Anonymous Fri Jul 15 11:21:57 2022 No.28238529 File: 472 KB, 746x726, 1657718621816.png [View same] [iqdb] [saucenao] [google] >>28238492 I miss him.

>>	Anonymous Fri Jul 15 11:22:20 2022 No.28238545 >>28238520 don't know, don't care. i watch nijisanji

>>	Anonymous Fri Jul 15 11:22:43 2022 No.28238556 >>28238504 They were needed to contain the schizos. But they keep breaking containment

>>	Anonymous Fri Jul 15 11:22:45 2022 No.28238559 I'm happy some of the EN members were able to play with Mayuzumi before he graduates :')

>>	Anonymous Fri Jul 15 11:23:53 2022 No.28238582 >>28238559 :'(

>>	Anonymous Fri Jul 15 11:24:23 2022 No.28238598 for some reason alban's stream keeps buffering for me while everyone else's is fine

>>	Anonymous Fri Jul 15 11:24:23 2022 No.28238597 >>28238530 maybe we can do somethi (USER WAS BANNED FOR THIS POST)

>>	Anonymous Fri Jul 15 11:24:34 2022 No.28238603 Is it wrong for me that I like anons arguing about Nijisanji last thread over any /soc/ and vocaroo posts?

>>	Anonymous Fri Jul 15 11:24:54 2022 No.28238613 >>28238598 weird, it's playing fine for me

>>	Anonymous Fri Jul 15 11:25:01 2022 No.28238617 >>28238603 yes

>>	Anonymous Fri Jul 15 11:25:15 2022 No.28238623 >>28238603 yeah

>>	Anonymous Fri Jul 15 11:25:15 2022 No.28238624 >>28238492 >>28238529 ;__;

>>	Anonymous Fri Jul 15 11:25:17 2022 No.28238626 >>28238435 I fucking hate these biased nigger mods so much

>>	Anonymous Fri Jul 15 11:25:30 2022 No.28238635 >>28238603 yes

>>	Anonymous Fri Jul 15 11:25:31 2022 No.28238636 >>28238597 I fucking pray one of you idiots become a janny and try to watch these threads

>>	Anonymous Fri Jul 15 11:25:33 2022 No.28238638 >>28238603 you can filter both so who cares

>>	Anonymous Fri Jul 15 11:25:40 2022 No.28238643 >>28238603 no

>>	Anonymous Fri Jul 15 11:25:56 2022 No.28238654 >>28238559 Can he come back like Sasaki when what bothered him disappear?

>>	Anonymous Fri Jul 15 11:26:39 2022 No.28238677 >>28238613 i can't even watch him properly on phone data wtf

>>	Anonymous Fri Jul 15 11:26:46 2022 No.28238678 File: 361 KB, 1536x1786, FSZETYcaIAAzPA5.jpg [View same] [iqdb] [saucenao] [google] >>28238624 Time is moving too slow.

>>	Anonymous Fri Jul 15 11:26:48 2022 No.28238680 >>28238617 >>28238623 >>28238635 commit die

>>	Anonymous Fri Jul 15 11:26:56 2022 No.28238686 >>28238654 I believe he's graduating completely.

>>	Anonymous Fri Jul 15 11:26:59 2022 No.28238687 >>28238603 that argument has been looped ten times over idc regardless anymore

>>	Anonymous Fri Jul 15 11:27:19 2022 No.28238695 File: 335 KB, 1536x1536, IMG_3409.jpg [View same] [iqdb] [saucenao] [google] cute collab! such a good well-rounded roster.

>>	Anonymous Fri Jul 15 11:27:22 2022 No.28238697 >>28238582 so glad the imposters won that last round with mayuyu finishing off the last survivor. perfect way to end the stream.

>>	Anonymous Fri Jul 15 11:27:22 2022 No.28238696 >>28238636 If I become jannie, I will probably become biggest bias nigger ever and remove all the briskadets post until they stop posting

>>	Anonymous Fri Jul 15 11:27:38 2022 No.28238704 Mysta is going to cook (a meal for me)

>>	Anonymous Fri Jul 15 11:27:42 2022 No.28238711 >>28238686 ; ;

>>	Anonymous Fri Jul 15 11:28:01 2022 No.28238719 >>28238654 his roommate's channel has been active lately so i guess he's just going to the flesh tuber route

>>	Anonymous Fri Jul 15 11:28:04 2022 No.28238720 >>28238654 he's not deleting his channel so there's a chance he also said he's 99.99% done, though

>>	Anonymous Fri Jul 15 11:28:06 2022 No.28238723 I will marry Mysta Rias.

>>	Anonymous Fri Jul 15 11:28:33 2022 No.28238733 >>28238677 I don't even have his stream on a lower quality and I'm casting to a smart TV so that is really weird, I'm sorry he's refusing to behave for you

>>	Anonymous Fri Jul 15 11:28:36 2022 No.28238734 Sonny's gone, but at least he's starting early tomorrow so I can have dinner, sleep and wake up to a stream. I love him so much. Otsonny!

>>	Anonymous Fri Jul 15 11:28:36 2022 No.28238735 >>28238517 Pain..I'll have to get used to the 'no kyodai' thing.

>>	Anonymous Fri Jul 15 11:28:39 2022 No.28238736 >>28238723 Sorry, he's already married to me.

>>	Anonymous Fri Jul 15 11:28:53 2022 No.28238744 >>28238678 Time moves slow when you wait and keep thinking about him. It’s time to find something else to keep you busy…

>>	Anonymous Fri Jul 15 11:29:06 2022 No.28238754 File: 101 KB, 300x300, 1657788280102.png [View same] [iqdb] [saucenao] [google] >>28238696 im innocent

>>	Anonymous Fri Jul 15 11:29:21 2022 No.28238765 Its not fair... I was supposed to be the psychopath of Niji EN... Not Sonny

>>	Anonymous Fri Jul 15 11:29:59 2022 No.28238782 >>28238735 I may be going schizo, but did Sonny or Alban mention the onii/otouto thing at all during the collab?

>>	Anonymous Fri Jul 15 11:30:13 2022 No.28238788 >>28238345 >nerd but hate school >professor Leos......

>>	Anonymous Fri Jul 15 11:30:16 2022 No.28238792 >>28238765 You'll just have to one up him

>>	Anonymous Fri Jul 15 11:30:17 2022 No.28238794 >>28238696 It's never worth being moderation.

>>	Anonymous Fri Jul 15 11:30:26 2022 No.28238806 >>28238736 Proof?

Anonymous Fri Jul 15 11:30:40 2022 No.28238818
File: 361 KB, 478x537, 1642788344416.png [View same] [iqdb] [saucenao] [google]

>>28238369
I almost had a relationship with a Touhou crossdresser but I just couldn't take how narcissistic he was. It was really frustrating how physically attracted I was to him in cosplay when he was rping as the characters or doing a photoshoot. But when he took it off he had a very vile personality that made me stop talking to him before we ever had sex due to how often he'd shit on people for not being as pretty as him or start verbal slapfights with random strangers, especially women, just because they were breathing the same air as him.

In hindsight I should've just sucked up my pride and taken the chance to lose my virginity. I still fap to some of his Marisa sets from time to time tho.

>>	Anonymous Fri Jul 15 11:30:40 2022 No.28238819 Sorry Kindreds no Mr.coom stream https://twitter.com/Vox_Akuma/status/1547905473126379521

>>	Anonymous Fri Jul 15 11:30:43 2022 No.28238823 I thought vox bought a house for himself why did he have a roommate all of a sudden

>>	Anonymous Fri Jul 15 11:30:43 2022 No.28238824 File: 585 KB, 2000x3000, FVJB3cNVsAE_wTu.jpg [View same] [iqdb] [saucenao] [google] Finana anal

>>	Anonymous Fri Jul 15 11:31:11 2022 No.28238836 >>28238696 But I post using a female nijiEN chuuba image.

>>	Anonymous Fri Jul 15 11:31:15 2022 No.28238838 File: 360 KB, 1638x2048, FJthOAWXIAQkuc_.jpg [View same] [iqdb] [saucenao] [google] Bye for now Mysta... I think I'll try and nap for an hour before the goat simulator

>>	Anonymous Fri Jul 15 11:31:19 2022 No.28238842 >>28238782 Playing out their kink in an international collab isn't the politest of things to do i-it's just that, right?

>>	Anonymous Fri Jul 15 11:31:24 2022 No.28238847 >>28238788 he's not a prof he's a scientist who makes drugs

>>	Anonymous Fri Jul 15 11:31:40 2022 No.28238851 File: 5 KB, 346x39, 1638761143283.png [View same] [iqdb] [saucenao] [google] >>28238818 nice blog

>>	Anonymous Fri Jul 15 11:31:41 2022 No.28238853 >>28238823 he was Helping a roommate probably an old friend when he left

>>	Anonymous Fri Jul 15 11:31:41 2022 No.28238856 File: 2.09 MB, 4096x4096, Blanket.png [View same] [iqdb] [saucenao] [google] >>28238695 Yeah it was really fun! Seems like everyone had a good time and Alban was more confident with speaking jp. So happy I stayed up until 4:30 am to watch it.

Anonymous Fri Jul 15 11:31:42 2022 No.28238855
File: 137 KB, 671x1100, FQbrrc2VsAQzvPa.jpg [View same] [iqdb] [saucenao] [google]

>>28238744
No. I want to suffer if it's for him. Waiting is not the worst thing that could've happened. And I'm actually excited today, Reimu-chan's cover is going to premier in just a few hours.

Anonymous Fri Jul 15 11:32:29 2022 No.28238882
File: 154 KB, 936x1164, FIHCZuxUcAIbV9o.jpg [View same] [iqdb] [saucenao] [google]

Mysta's gone... He was so cute this morning! Can't wait for his next stream.

>>28238838
I was considering a nap as well, but now I'm wide awake... Guess I'll do some work.

>>	Anonymous Fri Jul 15 11:32:36 2022 No.28238887 >>28238842 >spoiler didn't they do it during the jp valorant stream?

>>	Anonymous Fri Jul 15 11:32:39 2022 No.28238888 File: 40 KB, 512x508, 1657778845254.jpg [View same] [iqdb] [saucenao] [google] >>28238823 He has a girlfriend, she relocated from Hong Kong.

>>	Anonymous Fri Jul 15 11:32:45 2022 No.28238892 >>28238696 They're the most annoying posters I've seen in this thread. They singlehandedly managed to make me annoyed just by seeing the guys face now and that's something no other group has achieved.

>>	Anonymous Fri Jul 15 11:32:49 2022 No.28238894 >>28238818 >start verbal slapfights with random strangers, especially women Gay men are usually giga misogynistic

>>	Anonymous Fri Jul 15 11:32:49 2022 No.28238895 File: 251 KB, 1200x845, F5A1C51A-C8A6-4A43-A786-03BCAD3526D2.jpg [View same] [iqdb] [saucenao] [google] Time to watch leos. How is Shu doing? I was watching the project winter collab

Anonymous Fri Jul 15 11:32:56 2022 No.28238899

>>28238719
>>28238720
Yeah I know but mayuyu is not like his roommate so we really going to lose him after he graduate and I thought he would come back since he will not delete anything and that the only issue he had was with the way anycolor wants to go with the vtuber mayuzumi Kai. But if he really decide to go so be it but I'm really gonna miss him.

>>	Anonymous Fri Jul 15 11:33:17 2022 No.28238916 Sukoya collanbng with EN is so nice. Now it's time for Hoshikawa to do the same.

>>	Anonymous Fri Jul 15 11:33:19 2022 No.28238918 Is there a way to enjoy male VTubers without being demonized by literally everyone

>>	Anonymous Fri Jul 15 11:33:50 2022 No.28238934 >>28238887 yeah they did but there's potential that they reliased that maybe they were taking it too far

>>	Anonymous Fri Jul 15 11:33:56 2022 No.28238938 >>28238823 He didn't buy a house, he's renting. It sounds like he helped his old roommates move, but it doesn't mean they moved with him.

>>	Anonymous Fri Jul 15 11:34:06 2022 No.28238946 >>28238918 Just dont read the thread and look at the board retard

>>	Anonymous Fri Jul 15 11:34:08 2022 No.28238949 >>28238899 what did anykara want to do with mayuzumi kai? i'm actually lost

>>	Anonymous Fri Jul 15 11:34:42 2022 No.28238969 >>28238895 His stats are still pretty bad but Leos keeps using him as the pitcher for the 9th innning to train him

>>	Anonymous Fri Jul 15 11:34:53 2022 No.28238975 >>28238949 Dunno but it was creative differences that made him graduate

>>	Anonymous Fri Jul 15 11:34:54 2022 No.28238976 >>28238918 be male first and foremost

>>	Anonymous Fri Jul 15 11:35:03 2022 No.28238987 >>28238918 Do it in your own corner out of the sight of everyone else like the nijimale thread.

>>	Anonymous Fri Jul 15 11:35:35 2022 No.28238998 >>28238918 Get off 4chan and get on literally any other social platform. The view of this place is a very small minority that is disconnected with reality.

Anonymous Fri Jul 15 11:36:04 2022 No.28239021
File: 49 KB, 950x950, F46258A0-5F71-467D-90BE-43AC3AA1212F.jpg [View same] [iqdb] [saucenao] [google]

>>28238855
Understandable, I couldn’t take my mind off my oshi during the worst of times even if I wanted. I just hope that you can keep it in moderation so it doesn’t drain you too much

>>	Anonymous Fri Jul 15 11:36:19 2022 No.28239031 uwaah i hope sonny gets to collaborate more with his jp senpai

>>	Anonymous Fri Jul 15 11:36:36 2022 No.28239037 >>28238918 grow a fucking spine

>>	Anonymous Fri Jul 15 11:36:43 2022 No.28239044 File: 1.98 MB, 1170x2532, 1630700909191.png [View same] [iqdb] [saucenao] [google] https://www.youtube.com/watch?v=pQmpjFmB9yg

>>	Anonymous Fri Jul 15 11:36:44 2022 No.28239046 >>28238899 Maybe he'll come back if anykara backpedals on their numberagotry new policies.

>>	Anonymous Fri Jul 15 11:36:46 2022 No.28239048 File: 283 KB, 1448x2048, 64D7CF78-91FD-4A6D-9D38-87ABBE3FF394.jpg [View same] [iqdb] [saucenao] [google] Good morning!! Milord LOVE!!

>>	Anonymous Fri Jul 15 11:37:05 2022 No.28239060 File: 202 KB, 1451x1664, A72EA530-A965-4DBC-9296-0A94FFF52029.jpg [View same] [iqdb] [saucenao] [google] >>28238969 Ganbare shubert…

>>	Anonymous Fri Jul 15 11:37:16 2022 No.28239068 File: 87 KB, 840x1033, 20220715_063657.jpg [View same] [iqdb] [saucenao] [google] I love Seffyna she is my beautiful seiso K-Fairy gf (ง -᷄ω-᷅ )ว ٩( -᷄ω-᷅ )۶(ง-᷄ω-᷅ )ว ( -᷄ω-᷅ و(و

>>	Anonymous Fri Jul 15 11:37:33 2022 No.28239077 Mayuyu still has a collab on 24th where he might invite international livers for a linguistics radio stream. It's basically a podcast discussing language

>>	Anonymous Fri Jul 15 11:37:43 2022 No.28239080 >>28238975 that's...sad. i thought he just wanted to quit which is much more understandable

>>	Anonymous Fri Jul 15 11:38:27 2022 No.28239103 >>28239044 https://www.youtube.com/watch?v=-B2yzG6Gj0A

>>	Anonymous Fri Jul 15 11:38:58 2022 No.28239118 File: 144 KB, 650x500, FWJugHpUcAAA8AM.png [View same] [iqdb] [saucenao] [google] >>28239021 As soon as he comes back, everything will be okay again. Thank you.

>>	Anonymous Fri Jul 15 11:39:05 2022 No.28239122 File: 196 KB, 1777x1360, BF0C9979-4C5A-4520-80CE-CAC2961E7E7B.jpg [View same] [iqdb] [saucenao] [google] >>28239048 Good morning!

>>	Anonymous Fri Jul 15 11:39:24 2022 No.28239127 File: 345 KB, 1700x1519, aikou.jpg [View same] [iqdb] [saucenao] [google] >>28238492 i hope he's having a lot of fun.. i miss him so much.

Anonymous Fri Jul 15 11:39:25 2022 No.28239129

>>28238949
It's all just rrats and speculation but my personal take is he wanted to spend his earnings on some grand ARG game but management wouldn't give him permission to do anything that involves a real life ARG so he bailed.
In hindsight w/ Abe's assassination I think a real life ARG would've had the potential to be a disaster like the Aqua Teen Hunger Force one so maybe it was for the best.

Keep in mind that's just my baseless speculation though and he's never said anything about it.

>>	Anonymous Fri Jul 15 11:39:39 2022 No.28239140 >>28239048 gm, the stream today seems ike it'd be fun!

>>	Anonymous Fri Jul 15 11:39:45 2022 No.28239146 File: 265 KB, 1181x1748, 1640111128294.jpg [View same] [iqdb] [saucenao] [google] >>28238744 Even in his absence I am unable to think about anything else, and even if I could, it would feel wrong. He is more valuable than anything in this world.

>>	Anonymous Fri Jul 15 11:39:51 2022 No.28239148 >>28238918 Use a male split or get an extension / kurobaex which allows you to filter and hide reply chains manually and by keyword

>>	Anonymous Fri Jul 15 11:39:56 2022 No.28239152 File: 306 KB, 1191x1684, 1629670397021.jpg [View same] [iqdb] [saucenao] [google] >>28239103 https://www.youtube.com/watch?v=Niaw3Ez0YLU

>>	Anonymous Fri Jul 15 11:40:37 2022 No.28239167 File: 138 KB, 1383x988, FHW3KUZVUAAkO8b.jpg [View same] [iqdb] [saucenao] [google] fun stream

>>	Anonymous Fri Jul 15 11:40:40 2022 No.28239170 >>28239140 oh wait...

>>	Anonymous Fri Jul 15 11:40:59 2022 No.28239181 I'm going to have sex with Mysta Rias.

>>	Anonymous Fri Jul 15 11:41:13 2022 No.28239190 File: 230 KB, 1600x2316, 1657885246368.jpg [View same] [iqdb] [saucenao] [google] >>28239140 Cancelled. Milord needed his rest. Stupid workaholic demon. Love him so much.

Anonymous Fri Jul 15 11:41:39 2022 No.28239205

>>28238918
Use /luxnoc/ or make your own imageboard or go to female-dominated imageboards like lolcow.
Or just join the fan discords I guess.
I'm not a woman but as a Nijifag on 4chan I'm so used to people shitting on the vtubers I like that it doesn't bother me.

>>	Anonymous Fri Jul 15 11:41:39 2022 No.28239206 File: 42 KB, 200x200, 1645838508971.png [View same] [iqdb] [saucenao] [google] >>28239048 good morning

>>	Anonymous Fri Jul 15 11:41:49 2022 No.28239217 So the Shoto faggot will fuck off from now on and goes to leech holostarEN instead? Seem like a win for me

>>	Anonymous Fri Jul 15 11:41:58 2022 No.28239223 File: 30 KB, 381x366, 1646034198370.jpg [View same] [iqdb] [saucenao] [google] >>28238918 what do you mean "enjoy" male vtubers? Are you dating one of them? I can't believe you'd do this, anon. we all feel a great sense of betrayal.

>>	Anonymous Fri Jul 15 11:42:08 2022 No.28239226 >>28239190 I just saw, it's a shame but I hope he gets a good rest

>>	Anonymous Fri Jul 15 11:42:44 2022 No.28239241 >>28239205 fan discords are full of underaged girls even i cant handle something like that

>>	Anonymous Fri Jul 15 11:42:56 2022 No.28239246 >>28239129 Wonder if he'll go to another corpo for his visions.

>>	Anonymous Fri Jul 15 11:43:03 2022 No.28239249 >>28239217 shoto's ties to niji en are older than niji en itself, we'll never be rid of him

>>	Anonymous Fri Jul 15 11:43:13 2022 No.28239255 >>28238918 No, this is a hobby dominated by straight guys

>>	Anonymous Fri Jul 15 11:43:23 2022 No.28239260 >>28239205 It really doesnt take much to get desensitized to it honestly

>>	Anonymous Fri Jul 15 11:43:47 2022 No.28239271 File: 261 KB, 1200x840, 6ED8EED7-BB5E-4335-A044-80C359BB0B53.jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Fri Jul 15 11:43:48 2022 No.28239272 >>28239217 I hope so, let him leech someone else, if even for a little bit.

>>	Anonymous Fri Jul 15 11:44:17 2022 No.28239291 >>28239271 All those women in that picture...

>>	Anonymous Fri Jul 15 11:45:19 2022 No.28239318 >>28239272 I think rather than leech, he’s going to promote them instead

>>	Anonymous Fri Jul 15 11:45:33 2022 No.28239325 Just got home. How was the project winter collab? Whose POV is good to watch?

>>	Anonymous Fri Jul 15 11:45:43 2022 No.28239327 >>28239249 Man, I hate Elira and her friends so much

>>	Anonymous Fri Jul 15 11:45:51 2022 No.28239331 >>28239271 with some artstyles you can just tell the artist mostly draws porn

>>	Anonymous Fri Jul 15 11:46:10 2022 No.28239341 File: 492 KB, 600x643, 12344562463546.gif [View same] [iqdb] [saucenao] [google] >>28239048 Good morning, have a good day

>>	Anonymous Fri Jul 15 11:46:17 2022 No.28239345 >>28239325 fun kek i only watch sonny's pov so cant really say which is the best.

>>	Anonymous Fri Jul 15 11:46:23 2022 No.28239349 File: 173 KB, 1221x752, EA558CB8-6CA9-440F-A6EE-884D7E146396.jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Fri Jul 15 11:46:44 2022 No.28239362 Leos said that worst case, his players all go to Tokyo Uni. His village is full of introverts that focus on studying for uni entrance exams instead of baseball.

>>	Anonymous Fri Jul 15 11:46:59 2022 No.28239367 >>28239325 Penny betrayal and Sonnyban went schizo

>>	Anonymous Fri Jul 15 11:47:09 2022 No.28239372 >>28239325 I only watched alban but no matter who you pick, for the last round, watch either him or sonny.

>>	Anonymous Fri Jul 15 11:47:46 2022 No.28239393 >>28239331 So that's why I felt like a sense of similarity and deja vu.

>>	Anonymous Fri Jul 15 11:47:48 2022 No.28239394 >>28239318 just watch him stop collab with nijiEN once holostarEN becomes bigger than nijiENmales like wha happened with Shigure Ui and other holowhores

>>	Anonymous Fri Jul 15 11:48:07 2022 No.28239406 >>28239325 It was fun. I'd go with Petra or Alban for the funniest moments, but every perspective was good. I was actually paying the most attention to Mayuyu, so you might enjoy his as well.

>>	Anonymous Fri Jul 15 11:48:08 2022 No.28239408 >>28239217 no. he’ll leech both nijiEN and starsEN for maximum output.

>>	Anonymous Fri Jul 15 11:48:48 2022 No.28239429 https://twitter.com/Mysta_Rias/status/1547910218524176385

>>	Anonymous Fri Jul 15 11:48:53 2022 No.28239433 >>28239394 Oh, I’ll be happy of that were to happen

>>	Anonymous Fri Jul 15 11:49:20 2022 No.28239441 Woke up an hour too early

>>	Anonymous Fri Jul 15 11:49:41 2022 No.28239450 >>28239441 go back to sleep then dummy

>>	Anonymous Fri Jul 15 11:49:47 2022 No.28239454 >>28239271 LIZE SEX

>>	Anonymous Fri Jul 15 11:49:55 2022 No.28239460 >>28239362 Oof…

>>	Anonymous Fri Jul 15 11:50:49 2022 No.28239493 >>28239362 thats kind of cute actually

>>	Anonymous Fri Jul 15 11:50:54 2022 No.28239495 >>28239429 >Cute Mysta tweet >Shoto making it sexual in the replies Every fucking time

>>	Anonymous Fri Jul 15 11:50:56 2022 No.28239497 >>28239271 Mysta's wide hips...

>>	Anonymous Fri Jul 15 11:51:11 2022 No.28239503 >>28239441 stick around for natsume's 3d

>>	Anonymous Fri Jul 15 11:51:13 2022 No.28239505 >>28239406 >>28239372 >>28239367 >>28239345 Thanks. I'll catch up with the vods

>>	Anonymous Fri Jul 15 11:51:14 2022 No.28239506 >>28239394 You guys are just making StarsEN's potential success sound better and better. God I hope they blow up and become super popular.

>>	Anonymous Fri Jul 15 11:51:35 2022 No.28239515 >>28239497 Perfect for breeding…

>>	Anonymous Fri Jul 15 11:51:35 2022 No.28239514 Merry Christmas, Seffyna

>>	Anonymous Fri Jul 15 11:51:40 2022 No.28239521 Dead hours... should i watch tokyo godfathers or paprika

>>	Anonymous Fri Jul 15 11:52:09 2022 No.28239542 >>28239362 >shu >oliver >axia >kaede >kaida >salome I kinda understand why

>>	Anonymous Fri Jul 15 11:52:12 2022 No.28239545 This is /NijiEn/ thread, use your damn thread to discuss it

>>	Anonymous Fri Jul 15 11:52:25 2022 No.28239550 >>28239521 Watch Resident Evil

>>	Anonymous Fri Jul 15 11:52:28 2022 No.28239551 >>28239515 I want to put a baby in him...

>>	Anonymous Fri Jul 15 11:52:29 2022 No.28239552 >>28239521 do some push ups

>>	Anonymous Fri Jul 15 11:53:05 2022 No.28239572 >>28239362 >his team has nerd virgin loser, virgin loser, professor, ojou sama rp, jk and Japanese men who do not speak Japanese fluently Leos.....

>>	Anonymous Fri Jul 15 11:53:10 2022 No.28239578 >>28239521 seffy is doing karaoke if you're interested

>>	Anonymous Fri Jul 15 11:53:13 2022 No.28239580 >>28239552 I already did my daily jogging reps...

>>	Anonymous Fri Jul 15 11:53:48 2022 No.28239604 >>28239503 I will now

>>	Anonymous Fri Jul 15 11:54:59 2022 No.28239641 I'm not even a quilldren but man, I really wish Ike was streaming right now

>>	Anonymous Fri Jul 15 11:55:11 2022 No.28239650 File: 728 KB, 1448x2048, FXs9P5-UIAEtjkn.jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Fri Jul 15 11:55:30 2022 No.28239662 File: 289 KB, 598x778, 1657573388849.png [View same] [iqdb] [saucenao] [google] >>28239521 Time for VODs for me. I want to see some sheep.

>>	Anonymous Fri Jul 15 11:55:57 2022 No.28239677 >>28239662 She’s a cutie.

>>	Anonymous Fri Jul 15 11:56:03 2022 No.28239680 >>28239641 I do too.

>>	Anonymous Fri Jul 15 11:56:08 2022 No.28239683 >>28239545 Townbike of /vt/....

>>	Anonymous Fri Jul 15 11:56:09 2022 No.28239684 >>28239650 Enna and Reimu?

>>	Anonymous Fri Jul 15 11:57:34 2022 No.28239729 https://twitter.com/Naraka_2434/status/1547911272423116801

>>	Anonymous Fri Jul 15 11:57:46 2022 No.28239738 >>28239683 I can’t believe we’re all whores…

>>	Anonymous Fri Jul 15 11:57:57 2022 No.28239747 File: 103 KB, 736x1308, 1657617694623.jpg [View same] [iqdb] [saucenao] [google] Nijidead

>>	Anonymous Fri Jul 15 11:58:22 2022 No.28239755 I have a recurring dream/nightmare that I’m having sex and just take a fat piss in a girl. What’s wrong with me /nijien/?

>>	Anonymous Fri Jul 15 11:58:52 2022 No.28239767 File: 593 KB, 1798x1989, FU3Ze6PaIAIeZVP.jpg [View same] [iqdb] [saucenao] [google] >>28239429 I cooked his favourite tomato soup yesterday, he's bound to love it. Open wide~~

>>	Anonymous Fri Jul 15 11:58:53 2022 No.28239768 >>28239362 >>28239542 To be clear, village of introverts refers to the fact that majority of the players and npcs Leos rolled all had the 内気 Shy personality not the personalities of the livers themselves

>>	Anonymous Fri Jul 15 11:58:58 2022 No.28239772 >>28239729 Roco could've been the 5th member

>>	Anonymous Fri Jul 15 11:59:55 2022 No.28239793 >>28239255 Guys who frequently fap to cross players and traps

>>	Anonymous Fri Jul 15 12:00:18 2022 No.28239805 File: 2.62 MB, 498x398, clint-eastwood-cowboy.gif [View same] [iqdb] [saucenao] [google] >>28239545 /NijiEN/ is the wild west, pilgrim.

>>	Anonymous Fri Jul 15 12:00:20 2022 No.28239806 >>28239755 empty your bladder before going to bed

>>	Anonymous Fri Jul 15 12:00:50 2022 No.28239823 I feel like everyone always underestimates Mysta. It makes me prouder when he accomplishes things.

>>	Anonymous Fri Jul 15 12:00:58 2022 No.28239827 >>28239755 Why not pee in their butts?

>>	Anonymous Fri Jul 15 12:01:05 2022 No.28239835 >>28239641 to think there used to be a time where he hardly streamed or had more than one rest day.. it's hard to get used to him being on break now.

>>	Anonymous Fri Jul 15 12:01:16 2022 No.28239842 File: 132 KB, 1696x954, 1635504670370.jpg [View same] [iqdb] [saucenao] [google] >>28239521 Watching Made in Abyss Season 2

>>	Anonymous Fri Jul 15 12:01:18 2022 No.28239846 >>28239217 I wish he leech Holomen, then his fandom going apeshit and cancelling him to graduation

>>	Anonymous Fri Jul 15 12:01:29 2022 No.28239854 File: 87 KB, 1080x1118, 1627037655717.jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Fri Jul 15 12:01:36 2022 No.28239860 https://youtu.be/1uKKrPccLo0 Nachume 3D

>>	Anonymous Fri Jul 15 12:01:56 2022 No.28239876 Why don't we split and make this for NijiEN females only. Samefagging mod said it was ok and the Hololive threads are planning to do that. This shit is stupid having to share the thread with fujos

>>	Anonymous Fri Jul 15 12:02:37 2022 No.28239905 >>28239684 Fuuchan, this is based on their interaction in the trolley collab

>>	Anonymous Fri Jul 15 12:02:40 2022 No.28239908 >>28239823 >It makes me prouder when he accomplishes things we all feel that for our oshis but also good for him

>>	Anonymous Fri Jul 15 12:02:55 2022 No.28239916 >>28239860 She's already being cute!

>>	Anonymous Fri Jul 15 12:03:08 2022 No.28239921 >>28239876 shut the fuck up holotourist, kys

>>	Anonymous Fri Jul 15 12:03:15 2022 No.28239930 File: 352 KB, 1800x1013, dead_city_-_detail.jpg [View same] [iqdb] [saucenao] [google] /NijiEn/ current state Now Just waiting for someone baiting...

>>	Anonymous Fri Jul 15 12:03:15 2022 No.28239931 >>28239876 Why don't you suck my penis

>>	Anonymous Fri Jul 15 12:03:16 2022 No.28239932 >>28239876 whatever you say meido

>>	Anonymous Fri Jul 15 12:03:17 2022 No.28239933 >>28239860 She looks like she could actually exist.

>>	Anonymous Fri Jul 15 12:03:24 2022 No.28239937 Reimu cover in an hour!

>>	Anonymous Fri Jul 15 12:03:39 2022 No.28239944 >>28239876 Because everyone always spergs out and cries /loe/schizo when an attempt is made. Best you can try to do is try to push the females to their already existing split.

>>	Anonymous Fri Jul 15 12:03:58 2022 No.28239959 >>28239876 malepregs you

>>	Anonymous Fri Jul 15 12:04:08 2022 No.28239965 >>28239937 the song itself fucking sucks why couldn't she choose something else?

>>	Anonymous Fri Jul 15 12:04:26 2022 No.28239976 Look at her go?

>>	Anonymous Fri Jul 15 12:04:38 2022 No.28239986 >>28239876 Pumps your trembling boywomb full of cum

>>	Anonymous Fri Jul 15 12:04:40 2022 No.28239989 >>28239908 Of course. It's not a competition after all.

>>	not a samefag Fri Jul 15 12:04:46 2022 No.28239992 >>28239876 dude i agree

>>	Anonymous Fri Jul 15 12:05:18 2022 No.28240002 >>28239876 gives you an abortion

>>	Anonymous Fri Jul 15 12:05:27 2022 No.28240008 >>28239944 >push the females to their already existing split they're alright they can stay. the tourist needs to go tho

>>	Anonymous Fri Jul 15 12:05:34 2022 No.28240013 File: 422 KB, 1164x936, 1655458475267.jpg [View same] [iqdb] [saucenao] [google] feeling good today bros

>>	Anonymous Fri Jul 15 12:05:58 2022 No.28240027 >>28239986 Do me next please

>>	Anonymous Fri Jul 15 12:05:59 2022 No.28240029 >>28239876 malepregs you a 2nd time and then abort it

>>	Anonymous Fri Jul 15 12:06:09 2022 No.28240034 File: 66 KB, 180x180, 1647934652398.png [View same] [iqdb] [saucenao] [google] >>28238918 Everyone gets demonized here. Male, female, trans Vtubers. Don't start this gender shit again.

>>	Anonymous Fri Jul 15 12:06:19 2022 No.28240039 >>28239860 Exposed pits... sex...

>>	Anonymous Fri Jul 15 12:06:35 2022 No.28240049 File: 145 KB, 288x253, 1646563275975.png [View same] [iqdb] [saucenao] [google] >>28240013 kicks ur shin

>>	Anonymous Fri Jul 15 12:06:40 2022 No.28240055 >>28239876 feeds you your own aborted fetus

>>	Anonymous Fri Jul 15 12:06:45 2022 No.28240061 >>28239876 m.pregs you, aborts your child and eat it

>>	Anonymous Fri Jul 15 12:06:52 2022 No.28240064 >>28240013 not feeling good yet but looking forward to today

>>	Anonymous Fri Jul 15 12:06:55 2022 No.28240071 >>28240013 I order you to shit up the catalog, aloucreeps

>>	Anonymous Fri Jul 15 12:06:58 2022 No.28240074 i miss natsume's first outfit, bros...

>>	Anonymous Fri Jul 15 12:07:02 2022 No.28240075 >>28239876 take your meds

>>	Anonymous Fri Jul 15 12:07:22 2022 No.28240083 >>28240055 >>28240061 Why are Briskadets like this?

>>	Anonymous Fri Jul 15 12:07:32 2022 No.28240086 >>28240074 I kind of do as well, but this one is really pretty.

>>	Anonymous Fri Jul 15 12:07:36 2022 No.28240087 >>28240049 your heartless assault will do nothing to change my mood, bitch >>28240071 why would i do that that's mean

>>	Anonymous Fri Jul 15 12:07:58 2022 No.28240106 File: 248 KB, 384x649, 1656557410934.png [View same] [iqdb] [saucenao] [google] >>28239876 The amount of (You's) you get will be the number of times oji san cums inside you

>>	Anonymous Fri Jul 15 12:08:13 2022 No.28240113 sucks that mananatsu aren't close with each other i would love to see mashiro in 3d again

>>	Anonymous Fri Jul 15 12:08:22 2022 No.28240121 File: 563 KB, 500x1246, Kurusu_Natsume_-_Full_Illustration.png [View same] [iqdb] [saucenao] [google] >>28240074 ehh the current outfit is cuter

>>	Anonymous Fri Jul 15 12:08:28 2022 No.28240125 I got gifted my 7th membership....

>>	Anonymous Fri Jul 15 12:08:47 2022 No.28240134 >>28240074 I like this one. It suits her a lot better.

>>	Anonymous Fri Jul 15 12:08:54 2022 No.28240141 File: 205 KB, 1280x1280, 1655548275459.jpg [View same] [iqdb] [saucenao] [google] >>28239271 I fucking hope the degen trio gets playing time.

>>	Anonymous Fri Jul 15 12:08:59 2022 No.28240143 >>28239959 >>28240002 >>28240029 >>28239986 I can't wait for women to leave for homostarsEN

>>	Anonymous Fri Jul 15 12:09:00 2022 No.28240144 >>28240125 i haven't got a single one you bitches are lucky

>>	Anonymous Fri Jul 15 12:09:26 2022 No.28240168 File: 117 KB, 1726x1169, 1642481432976.jpg [View same] [iqdb] [saucenao] [google] >>28240087 t poses in your general direction

>>	Anonymous Fri Jul 15 12:09:26 2022 No.28240167 >>28240125 whore

>>	Anonymous Fri Jul 15 12:09:27 2022 No.28240169 >>28240143 You are now pregnant with my child.

>>	Anonymous Fri Jul 15 12:09:29 2022 No.28240171 >>28240074 The first outfit doesn't suit her personality. This one does

>>	Anonymous Fri Jul 15 12:09:37 2022 No.28240177 >>28240125 How...

>>	Anonymous Fri Jul 15 12:09:57 2022 No.28240187 >>28240143 >>28240106

>>	Anonymous Fri Jul 15 12:10:24 2022 No.28240212 >>28240125 i-i never got gifted with any memberships...

>>	Anonymous Fri Jul 15 12:10:28 2022 No.28240213 File: 73 KB, 220x215, 1637197171521.png [View same] [iqdb] [saucenao] [google] >>28240168 go erp with a pomudachi or something

>>	Anonymous Fri Jul 15 12:10:36 2022 No.28240217 >>28240143 They haven't even debuted yet and they're already flops. Barely any promotion. Trailer doesn't have 70k views. Don't count on any "fujoshart femcels" leaving anytime soon.

>>	Anonymous Fri Jul 15 12:10:44 2022 No.28240219 File: 3 KB, 125x125, 1654684387023s.jpg [View same] [iqdb] [saucenao] [google] >>28240125 Where's mine...

>>	Anonymous Fri Jul 15 12:10:53 2022 No.28240224 >>28240168 >Cunny >Does nothing with her cunny model What's the point of this penguin bitch again? I heard she was supposed to be the Gura killer or some dumb shit like that

>>	Anonymous Fri Jul 15 12:11:27 2022 No.28240248 File: 2.93 MB, 313x336, 1654408885132.gif [View same] [iqdb] [saucenao] [google] >>28240213 i dont do that shit fuck you are you mad lmao heheheheheheh >>28240224 dont talk to me

>>	Anonymous Fri Jul 15 12:11:37 2022 No.28240255 >>28240224 She's cute.

>>	Anonymous Fri Jul 15 12:12:07 2022 No.28240266 Has her light novel been released yet? How's the reviews?

>>	Anonymous Fri Jul 15 12:12:38 2022 No.28240284 File: 103 KB, 850x1478, 4222F975-7177-48E8-9802-89F2A9C83360.jpg [View same] [iqdb] [saucenao] [google] What's an alternate outfit you'd like to see your oshi wear?

>>	Anonymous Fri Jul 15 12:12:40 2022 No.28240285 File: 1.72 MB, 2480x3508, 1650017063777.png [View same] [iqdb] [saucenao] [google] birb

>>	Anonymous Fri Jul 15 12:12:47 2022 No.28240288 ENTER TENGU

>>	Anonymous Fri Jul 15 12:12:58 2022 No.28240293 Was the propnight collab good ? I didn't know they had one.

Anonymous Fri Jul 15 12:13:14 2022 No.28240302
File: 290 KB, 1920x1080, FXojxYsaQAAnF6b.jpg [View same] [iqdb] [saucenao] [google]

>>28240171
yeah, i get that. it's cuter and suits her much better, i just personally like the first one a bit more as a design.
i just miss it sometimes... all natsume is cute though.

>>	Anonymous Fri Jul 15 12:13:20 2022 No.28240305 Tengu tits

>>	Anonymous Fri Jul 15 12:13:21 2022 No.28240307 >>28240266 sold enough to warrant a second volume

>>	Anonymous Fri Jul 15 12:13:40 2022 No.28240312 I missed the project winter collab...

>>	Anonymous Fri Jul 15 12:13:45 2022 No.28240315 File: 230 KB, 999x725, 1651310942244.jpg [View same] [iqdb] [saucenao] [google] I miss Petora..

>>	Anonymous Fri Jul 15 12:14:13 2022 No.28240334 >>28240305 For me, it's the tengu thighs

>>	Anonymous Fri Jul 15 12:14:13 2022 No.28240333 >>28240217 Watch they have one male with Vox's voice and explode with fujo audience

>>	Anonymous Fri Jul 15 12:14:24 2022 No.28240339 File: 126 KB, 916x1126, 1627808872962.jpg [View same] [iqdb] [saucenao] [google] >>28240248 are you mad that i called you out pentomo heheheheh

>>	Anonymous Fri Jul 15 12:14:30 2022 No.28240341 >>28240315 Me too

>>	Anonymous Fri Jul 15 12:14:32 2022 No.28240344 >>28240307 Wonder if there will be an EN fan translation for it.

>>	Anonymous Fri Jul 15 12:14:42 2022 No.28240348 >>28240312 it was boring

>>	Anonymous Fri Jul 15 12:14:51 2022 No.28240350 Knee length skirts really are great, it’s really cute how bouncy it is

>>	Anonymous Fri Jul 15 12:15:08 2022 No.28240361 >>28240333 Unless he's willing to do extremely heavily BFE like Vox he still won't make it.

>>	Anonymous Fri Jul 15 12:15:27 2022 No.28240370 >>28240224 She's cute, retard. >Gura killer None of the Niji lolis meme around with their loli status enough though, I agree. Holo kinda dominates on that front.

>>	Anonymous Fri Jul 15 12:15:33 2022 No.28240373 >>28240284 Basketball uniform

>>	Anonymous Fri Jul 15 12:15:35 2022 No.28240374 >>28240293 it was okay. not really amazing or anything, just a normal collab.

>>	Anonymous Fri Jul 15 12:15:47 2022 No.28240381 >>28240361 Still have my fingers crossed waiting for Vox breeding/pregnancy ASMR… please… I need it…

>>	Anonymous Fri Jul 15 12:15:53 2022 No.28240385 File: 133 KB, 1170x864, 1643323323515.jpg [View same] [iqdb] [saucenao] [google] >>28240339 im not mad and you didnt call me out hmph

>>	Anonymous Fri Jul 15 12:16:04 2022 No.28240390 >>28240333 Vox is appealing to female coomers. I don't think any of the stars can do that.

>>	Anonymous Fri Jul 15 12:16:07 2022 No.28240393 >>28240217 trailer doesn't show any designs, that's why

>>	Anonymous Fri Jul 15 12:16:41 2022 No.28240417 >>28240284 military pommers with a tanktop, cargo pants, and boots

>>	Anonymous Fri Jul 15 12:16:51 2022 No.28240418 File: 553 KB, 1170x720, 14664597436.png [View same] [iqdb] [saucenao] [google] >>28240339 Don't you have a court appearance for animal abuse to attend to?

>>	Anonymous Fri Jul 15 12:17:03 2022 No.28240422 >>28240381 He said breed yesterday before adding it to the buzzer list...

>>	Anonymous Fri Jul 15 12:17:12 2022 No.28240425 >>28240333 Vox is declining though. Appealing to females is shit and especially when you want to play games and they're not interested in watching you do that.

>>	Anonymous Fri Jul 15 12:17:29 2022 No.28240434 >>28240284 Nude

>>	Anonymous Fri Jul 15 12:17:33 2022 No.28240438 Elira Pendora's big fat sweaty dragon milkers

>>	Anonymous Fri Jul 15 12:17:34 2022 No.28240441 lesbian tengu...

>>	Anonymous Fri Jul 15 12:17:41 2022 No.28240445 >>28240284 i second this >>28240417

>>	Anonymous Fri Jul 15 12:17:43 2022 No.28240446 >>28240425 thats not the case though, Mysta is doing just fine

>>	Anonymous Fri Jul 15 12:17:48 2022 No.28240448 >>28238918 be Japanese

>>	Anonymous Fri Jul 15 12:18:37 2022 No.28240477 File: 253 KB, 2048x2048, 72CB6867-F719-47ED-BFBE-F1416B8DF888.jpg [View same] [iqdb] [saucenao] [google] >>28240422 We’re getting closer, sisters… One day he’ll have a “I’m gonna knock you up” subplot in one of his ASMRs, I just know it…

>>	Anonymous Fri Jul 15 12:18:43 2022 No.28240482 >>28240418 >>28240385 i bet neither of you are pentomos

>>	Anonymous Fri Jul 15 12:19:07 2022 No.28240491 >>28239325 Mayuyu is really good at the game so his is great, I'd say just open several POVs and mute according to who's nearby

>>	Anonymous Fri Jul 15 12:19:12 2022 No.28240493 File: 109 KB, 794x669, 1656722552742.jpg [View same] [iqdb] [saucenao] [google] >>28240418 I'll show you animal abuse you little penguin

>>	Anonymous Fri Jul 15 12:19:15 2022 No.28240495 Lately I just leave my oshis videos playing 24/7 so I can always hear their voice and don't get lonely.

>>	Anonymous Fri Jul 15 12:19:29 2022 No.28240499 >anime girl promoting her light novel The future

>>	Anonymous Fri Jul 15 12:19:39 2022 No.28240505 >>28240425 Vox's main appeal was his ASME BFE. He then went on to insult his audience that was into that shit. The other males didn't put all of their eggs in one basket like him and don't have that problem.

>>	Anonymous Fri Jul 15 12:19:44 2022 No.28240509 >>28240495 least lonely pomudachi

>>	Anonymous Fri Jul 15 12:19:59 2022 No.28240517 File: 2.60 MB, 1900x1068, aswefqaewvqawegvqaewgqaweg.png [View same] [iqdb] [saucenao] [google] BUY HER BOOK

>>	Anonymous Fri Jul 15 12:20:02 2022 No.28240520 File: 1.91 MB, 800x800, 1649763386084.webm [View same] [iqdb] [saucenao] [google] >>28240284 Short shorts with a tank top.

>>	Anonymous Fri Jul 15 12:20:02 2022 No.28240519 >>28240425 hoeru brothers has a lot of female fans and they are fine

>>	Anonymous Fri Jul 15 12:20:19 2022 No.28240527 >>28240495 Mystake?

>>	Anonymous Fri Jul 15 12:20:22 2022 No.28240528 >>28240446 Didn't vox have a menhera moment cause his numbers were dropping? Last time I checked, Mysta isn't Vox, not sure why you brought him up.

>>	Anonymous Fri Jul 15 12:20:48 2022 No.28240542 >>28240284 edgy goth enna

>>	Anonymous Fri Jul 15 12:20:51 2022 No.28240545 >>28240517 >harem romcom higschool setting >female author I thought this was just a male thing

>>	Anonymous Fri Jul 15 12:21:08 2022 No.28240556 File: 132 KB, 800x450, 1648259711049.jpg [View same] [iqdb] [saucenao] [google] >People ITT already writing of HoloStarsEN

>>	Anonymous Fri Jul 15 12:21:08 2022 No.28240557 >>28240528 being slightly frustrated doesnt mean mental you ding bat

>>	Anonymous Fri Jul 15 12:21:33 2022 No.28240569 >>28240517 I wont it looks bad

>>	Anonymous Fri Jul 15 12:21:44 2022 No.28240575 >>28240528 It's because he wasn't happy with his content lately (and he's not getting enough sleep) also it wasn't menhera, he was just frustrated.

>>	Anonymous Fri Jul 15 12:22:06 2022 No.28240587 File: 261 KB, 946x2048, B31992E5-78FA-4999-82F0-759EDCD6D50C.jpg [View same] [iqdb] [saucenao] [google] What sexual fantasy about your oshi did you last masturbate to?

>>	Anonymous Fri Jul 15 12:22:13 2022 No.28240592 >>28240517 Need a scanlation group to pick it up first.

Anonymous Fri Jul 15 12:22:15 2022 No.28240593

>>28240425
Senpai females also like gaming, the reason why it seems like they're not interested with it because the society still repressed them in gaming community, that's why they're reluctant to shows up, some even choose to fake their genders in order to be accepted

If women in general dislike gaming OR if he's declining in gaming content, he'll only reach 1k ccv or even less

>>	Anonymous Fri Jul 15 12:22:37 2022 No.28240604 BLUE

>>	Anonymous Fri Jul 15 12:22:46 2022 No.28240610 So Shimon is there right? Shu and Elira will collab with him and give them a free advertising to fujo audience huh? If that happens I will become Elira and Shu's anti

>>	Anonymous Fri Jul 15 12:22:47 2022 No.28240613 File: 126 KB, 834x956, 666F5FB3-1B86-495F-B880-C8A7070CE3D8.jpg [View same] [iqdb] [saucenao] [google] >>28240587 Riding him while I’m 8 months pregnant and leaking milk

Anonymous Fri Jul 15 12:22:55 2022 No.28240623
File: 81 KB, 688x768, 109992015515.jpg [View same] [iqdb] [saucenao] [google]

>>28240482
Did you know Petra can play the recorder with her nose, and that she can play the guitar a bit too?

>>28240493
Keep piling up the charges buddy. You must really want that prison rape action.

>>	Anonymous Fri Jul 15 12:22:57 2022 No.28240626 File: 1.53 MB, 1442x2048, 1644778264215.png [View same] [iqdb] [saucenao] [google] https://twitter.com/toto_nizi/status/1547911873693372417 more shu fanart

>>	Anonymous Fri Jul 15 12:23:10 2022 No.28240633 >>28240587 her pissing on my face through her tights

>>	Anonymous Fri Jul 15 12:23:16 2022 No.28240635 >>28240593 Anybody who replies to this post after me sucks nigger dicks

>>	Anonymous Fri Jul 15 12:23:21 2022 No.28240638 >>28240217 >>28240393 The announcement tweet has a similar amount of likes as the Obsydia merch announcement and they both don't even show anything but a date

>>	Anonymous Fri Jul 15 12:23:34 2022 No.28240645 >>28240499 I hope that one day fuuchan will write a light novel and sell it.

Anonymous Fri Jul 15 12:23:40 2022 No.28240648

>>28240592
I have a feeling we'd get an official translation first then a fan one...
its not exactly complicated, but it depends on natchume if she wants it translated
go bug her in superchat or something later on when she shills vol2 in a later stream

>>	Anonymous Fri Jul 15 12:23:45 2022 No.28240652 >>28240527 I was talking about Elira.

>>	Anonymous Fri Jul 15 12:23:48 2022 No.28240653 >>28240610 If they are a flop and Stars management allows it, they'll collab 100%

>>	Anonymous Fri Jul 15 12:24:04 2022 No.28240664 File: 1.86 MB, 1442x2048, 1640484618472.png [View same] [iqdb] [saucenao] [google] >>28240626

>>	Anonymous Fri Jul 15 12:24:07 2022 No.28240666 File: 861 KB, 1280x922, 1630635267539.gif [View same] [iqdb] [saucenao] [google] pikapikapikapikapikachu

>>	Anonymous Fri Jul 15 12:24:10 2022 No.28240668 File: 316 KB, 1920x1080, 1657887744644.jpg [View same] [iqdb] [saucenao] [google] !!!!!!!!

>>	Anonymous Fri Jul 15 12:24:24 2022 No.28240673 File: 243 KB, 391x355, 1657801750728.png [View same] [iqdb] [saucenao] [google] >>28240593 So this is what NijisanjiEN is filled with lmao

>>	Anonymous Fri Jul 15 12:24:26 2022 No.28240678 >>28240348 that depends on who you watched

>>	Anonymous Fri Jul 15 12:24:26 2022 No.28240675 >>28240623 yeah of course i know that

>>	Anonymous Fri Jul 15 12:24:46 2022 No.28240684 >>28240668 Imagine the smell

>>	Anonymous Fri Jul 15 12:24:48 2022 No.28240686 >>28240673 me when I samefag

>>	Anonymous Fri Jul 15 12:25:36 2022 No.28240719 >>28240477 ... i believe...

>>	Anonymous Fri Jul 15 12:25:46 2022 No.28240724 >>28240673 shut up Childe

>>	Anonymous Fri Jul 15 12:26:26 2022 No.28240743 File: 211 KB, 714x825, 1442344301.png [View same] [iqdb] [saucenao] [google] >>28240675 Good you are now a Pentomo

>>	Anonymous Fri Jul 15 12:26:27 2022 No.28240745 >homostarsen >new nijijp wave En boys will lose a lot of asian fans

>>	Anonymous Fri Jul 15 12:26:40 2022 No.28240764 >>28240610 chimon randon aruvn hanbyeol there's your starsEN gen1

>>	Anonymous Fri Jul 15 12:26:57 2022 No.28240773 File: 23 KB, 314x314, 1646790843798.jpg [View same] [iqdb] [saucenao] [google] >>28240743 wtf

>>	Anonymous Fri Jul 15 12:27:24 2022 No.28240788 >>28240745 Holostars are literal whos in Japan and China doesn't like Hololive. So no.

>>	Anonymous Fri Jul 15 12:27:50 2022 No.28240802 THE CHAIR GIVE HIM THE CHAIR

>>	Anonymous Fri Jul 15 12:27:58 2022 No.28240808 >Mashiro and Naraka

>>	Anonymous Fri Jul 15 12:28:04 2022 No.28240810 >>28240333 One of them will be pure BFE, unlike Vox and his rape kinks for 14 year olds

>>	Anonymous Fri Jul 15 12:28:24 2022 No.28240829 >>28240764 Moe.....

>>	Anonymous Fri Jul 15 12:28:39 2022 No.28240842 >>28240810 based vox??

>>	Anonymous Fri Jul 15 12:28:53 2022 No.28240845 THE COMFYDANTS ARE RAPING NATSUME

>>	Anonymous Fri Jul 15 12:29:05 2022 No.28240853 >>28240788 >said increasingly nervous woman

>>	Anonymous Fri Jul 15 12:29:10 2022 No.28240858 >>28240425 In what way? Because you said he is? Or you keep reading over and over that he is? Is he?

>>	Anonymous Fri Jul 15 12:29:15 2022 No.28240861 I was thinking out of Luxiem what do you think their grooming habits are? Mysta is probably completely hairless besides his head and waxes his asshole for example.

>>	Anonymous Fri Jul 15 12:29:16 2022 No.28240863 >>28240764 Seems like randon is the only one who's remotely ok there.

>>	Anonymous Fri Jul 15 12:29:37 2022 No.28240875 >>28240810 >Rape kinks for 14 year olds Women are retarded it's what they like

>>	Anonymous Fri Jul 15 12:29:38 2022 No.28240876 >>28240495 I do that with Sonny's vods.... I must have replayed through his whole channel several times now...

>>	Anonymous Fri Jul 15 12:29:44 2022 No.28240878 >>28240810 >his rape kinks for 14 year olds I will now watch your ASMRtuber.

>>	Anonymous Fri Jul 15 12:29:50 2022 No.28240884 >>28240527 I should do it actually...

>>	Anonymous Fri Jul 15 12:29:57 2022 No.28240887 File: 755 KB, 890x653, 1657781162613.png [View same] [iqdb] [saucenao] [google] we're looping again it's all so tiring

>>	Anonymous Fri Jul 15 12:29:58 2022 No.28240890 >>28240861 >WAXING YOUR ASSHOLE

>>	Anonymous Fri Jul 15 12:29:58 2022 No.28240888 >>28240861 I thought you meant a different kind of grooming...

>>	Anonymous Fri Jul 15 12:30:09 2022 No.28240902 >>28240638 not a fair comparison, obsydia's been around for a year vs literal whos. maybe someone can find the first tweet/trailer for luxiem and compare their numbers with starsEN.

>>	Anonymous Fri Jul 15 12:30:19 2022 No.28240908 File: 72 KB, 867x732, F56B31A1-4E00-40DF-A2D5-0E3ADE096EE8.jpg [View same] [iqdb] [saucenao] [google] >>28240810 Vox raping me and babytrapping me…

>>	Anonymous Fri Jul 15 12:30:22 2022 No.28240912 do we really need so many boys doomposting timeloop?

>>	Anonymous Fri Jul 15 12:30:23 2022 No.28240913 >>28240853 Well, you got the femoid part right, but truthfully I wish they stood a chance. Competition is a good thing. The odds are just against them.

>>	Anonymous Fri Jul 15 12:30:35 2022 No.28240921 i want to erp with a rosebud

>>	Anonymous Fri Jul 15 12:30:40 2022 No.28240925 >>28240861 mysta never takes care of himself but is vulnerable enough to be groomed to the point that he epilates all of his bodyhair to crossdress more convincingly

>>	Anonymous Fri Jul 15 12:30:52 2022 No.28240933 You can tell it's tourists because they think Vox is BFE.

>>	Anonymous Fri Jul 15 12:31:00 2022 No.28240939 >>28240575 I can't believe anons twisted the story after the last stream

>>	Anonymous Fri Jul 15 12:31:05 2022 No.28240943 >>28240861 >grooming habits sonny's little sister anon...

>>	Anonymous Fri Jul 15 12:31:30 2022 No.28240963 >>28240764 Shu Fuuchan Ike Uki But holo.....

>>	Anonymous Fri Jul 15 12:31:35 2022 No.28240970 >>28240745 The reason nijiENmales become big in the first place was nijiJPmales were big, human is social creatures, they will gravitate toward the biggest circle

>>	Anonymous Fri Jul 15 12:31:39 2022 No.28240972 File: 322 KB, 798x784, 1650224261715.png [View same] [iqdb] [saucenao] [google] >>28240773 There's no escaping the basement now, bitch!

>>	Anonymous Fri Jul 15 12:31:42 2022 No.28240976 >>28240587 Loving baby making sex

>>	Anonymous Fri Jul 15 12:31:47 2022 No.28240981 >>28240921 theres one in vrc right now

>>	Anonymous Fri Jul 15 12:32:03 2022 No.28240987 >>28240933 Vox is fce. Favourite concubine experience

>>	Anonymous Fri Jul 15 12:32:14 2022 No.28240993 >>28240939 It's numberfags that don't watch streams, of course they twisted it.

>>	Anonymous Fri Jul 15 12:32:33 2022 No.28241003 >>28240933 they wouldn't understand that he's my wife(male)

Anonymous Fri Jul 15 12:32:39 2022 No.28241007

>>28240861
Mysta takes a bath every day and loves looking good but then he'll also wear the same clothes for 3 weeks without washing them because he doesn't leave the house. So his grooming habits could go either way, I feel. But he definitely shave when he crossdresses at the very least.

>>	Anonymous Fri Jul 15 12:32:44 2022 No.28241011 File: 155 KB, 2048x2048, babyshu1.jpg [View same] [iqdb] [saucenao] [google] Baby Shu!

>>	Anonymous Fri Jul 15 12:32:51 2022 No.28241017 Is Millie going to stream later without the handcam?

>>	Anonymous Fri Jul 15 12:32:53 2022 No.28241019 File: 32 KB, 824x132, 1630965895706.jpg [View same] [iqdb] [saucenao] [google] >>28240912

>>	Anonymous Fri Jul 15 12:33:00 2022 No.28241029 >>28240890 You don't wax your asshole?

>>	Anonymous Fri Jul 15 12:33:01 2022 No.28241034 >>28240933 Putting in my shift at the Vox ASME BFE watching factory

>>	Anonymous Fri Jul 15 12:33:10 2022 No.28241040 >>28240908 It wouldn't be baby trapping since I'd be fully willing but I wouldnt mind resisting a bit if he's like...

>>	Anonymous Fri Jul 15 12:33:12 2022 No.28241043 >>28240788 vox made a china mishap and his fans didn't care because he's hot girls don't care about nationalism, they just want a hot white male to jill off to

>>	Anonymous Fri Jul 15 12:33:14 2022 No.28241044 >>28241011 He's growing up??

>>	Anonymous Fri Jul 15 12:33:19 2022 No.28241046 >>28240987 Favorite cultist experience*

>>	Anonymous Fri Jul 15 12:33:20 2022 No.28241047 >>28240943 Shes adopted its different

>>	Anonymous Fri Jul 15 12:33:21 2022 No.28241049 >>28240933 Vox is AFE(autistic friend experience)

>>	Anonymous Fri Jul 15 12:33:59 2022 No.28241077 >>28240912 I just wish they'd loop in their own threads about this shit instead of coming here for some reason.

>>	Anonymous Fri Jul 15 12:34:08 2022 No.28241087 File: 295 KB, 737x418, BeachPetra.png [View same] [iqdb] [saucenao] [google] Rosemi-sama is very cute and I will be expanding my skincare routine.

>>	Anonymous Fri Jul 15 12:34:10 2022 No.28241088 File: 111 KB, 480x480, 1643402053864.png [View same] [iqdb] [saucenao] [google] femanons why wont you date pomudachis why are we so undesirable to women please help me to understand?

>>	Anonymous Fri Jul 15 12:34:27 2022 No.28241103 >thumbnail card battle vs Chaika

>>	Anonymous Fri Jul 15 12:34:27 2022 No.28241104 File: 531 KB, 1740x2048, 1657888456766.jpg [View same] [iqdb] [saucenao] [google] Vox is my house husband.

>>	Anonymous Fri Jul 15 12:34:30 2022 No.28241108 >>28241040 100% same. I want nothing more than to get knocked up by him, but imagine being babytrapped and forced into giving up your career by CEO Vox… Becoming his housewife instead…

>>	Anonymous Fri Jul 15 12:34:35 2022 No.28241112 >>28241043 Only his Taiwanese fans got buttblasted about that, not mainlanders. And everyone in China is a nationalist, they drill it into your heads in school. I remember one of the prominent Coco antis being a woman.

>>	Anonymous Fri Jul 15 12:34:41 2022 No.28241114 >>28241049 This kind of goes for Luxiem as a whole

>>	Anonymous Fri Jul 15 12:34:42 2022 No.28241116 >>28241088 lmfao, look at this nigga

>>	Anonymous Fri Jul 15 12:34:48 2022 No.28241124 >>28241088 stinkidachi

>>	Anonymous Fri Jul 15 12:35:19 2022 No.28241143 File: 206 KB, 515x470, 1654989213351.png [View same] [iqdb] [saucenao] [google] >>28241088

>>	Anonymous Fri Jul 15 12:35:31 2022 No.28241153 >>28241088 I love pomudachis!

>>	Anonymous Fri Jul 15 12:35:33 2022 No.28241157 >>28241088 pathetic

>>	Anonymous Fri Jul 15 12:35:33 2022 No.28241156 >>28241029 NO waxing it would be so painful???

>>	Anonymous Fri Jul 15 12:35:39 2022 No.28241160 >>28241088 give up on femanons pomie, it's not worth it.

>>	Anonymous Fri Jul 15 12:35:48 2022 No.28241168 StarsEN just needs to cater to the bros(me) and they'll do fine.

>>	Anonymous Fri Jul 15 12:36:01 2022 No.28241173 >>28241034 Which one are you watching? I need to catch up on some that sounded good.

>>	Anonymous Fri Jul 15 12:36:08 2022 No.28241178 >>28241114 Luca and Ike are not autistic

>>	Anonymous Fri Jul 15 12:36:08 2022 No.28241177 File: 125 KB, 512x512, eoC2Yvv3DMPp8wSN5Z2wAQ.png [View same] [iqdb] [saucenao] [google] I require big boobies in muh face

>>	Anonymous Fri Jul 15 12:36:25 2022 No.28241191 File: 642 KB, 1700x2000, 1633669038062.jpg [View same] [iqdb] [saucenao] [google] I love Rosemi with all of my heart!

>>	Anonymous Fri Jul 15 12:36:32 2022 No.28241197 is yugo being a lolicon

>>	Anonymous Fri Jul 15 12:36:41 2022 No.28241204 >>28241044 No, it's just summer time.

>>	Anonymous Fri Jul 15 12:36:56 2022 No.28241211 >>28240528 Not because of numbers, he thought his other content wasn't up to par compared to his best content (ASMR) >>28166010

>>	Anonymous Fri Jul 15 12:36:59 2022 No.28241212 >>28241178 >Ike Uhhhh

>>	Anonymous Fri Jul 15 12:37:01 2022 No.28241214 >>28241108 I'm not good at whatever I do anyway, so what's the use of wasting money to pay me? I could just stay home and have him provide for my every single need, I wouldn't have to worry about anything but looking pretty...

>>	Anonymous Fri Jul 15 12:37:08 2022 No.28241220 >>28241088 I love pomudachis! as a friend

>>	Anonymous Fri Jul 15 12:37:20 2022 No.28241231 >>28241173 Butler was really good and didn't have horny shit in it.

>>	Anonymous Fri Jul 15 12:37:28 2022 No.28241236 how is yugo's gacha skills on his pulls

>>	Anonymous Fri Jul 15 12:37:32 2022 No.28241242 >>28241088 i don't date anons unless it's sonny

>>	Anonymous Fri Jul 15 12:37:34 2022 No.28241244 >>28241178 >Luca Well…

>>	Anonymous Fri Jul 15 12:37:36 2022 No.28241248 >>28241088 I like Pomudachi when they're being cute and talking about Pomu's streams but I don't like them when they talk about how Pomu is the only non-NPC female in the whole world.

>>	Anonymous Fri Jul 15 12:37:38 2022 No.28241251 >>28241088 You're stinky.

>>	Anonymous Fri Jul 15 12:37:50 2022 No.28241257 Chaika is too op

>>	Anonymous Fri Jul 15 12:38:00 2022 No.28241266 File: 156 KB, 850x1202, 9209640576d496f3a4b528fd3f7d9a62.jpg [View same] [iqdb] [saucenao] [google] >>28241177 The best I can do given circumstances

Anonymous Fri Jul 15 12:38:37 2022 No.28241288
File: 117 KB, 1024x714, 1639167142029.jpg [View same] [iqdb] [saucenao] [google]

hey guys my shitbike still works!!!! i think the carb just got flooded but its back to normal now, i just need to fix the mirrors and wait for my shoulders to stop hurting then im gonna ride again!!

>>	Anonymous Fri Jul 15 12:38:38 2022 No.28241292 >left the thread open yesterday >come back >hundreds of deleted posts /NijiEn/ is going back in time

>>	Anonymous Fri Jul 15 12:38:39 2022 No.28241294 >>28241197 He's streaming? Yuguys...

>>	Anonymous Fri Jul 15 12:38:43 2022 No.28241300 >>28241177 A famelira posted this

>>	Anonymous Fri Jul 15 12:38:59 2022 No.28241312 >>28241257 He still plays Inscyption to this day!

>>	Anonymous Fri Jul 15 12:39:17 2022 No.28241327 >>28241214 Giving him oral under the kitchen table before he leaves for work in the morning...

>>	Anonymous Fri Jul 15 12:39:20 2022 No.28241328 File: 47 KB, 500x500, C28E8823-4BBA-488F-8A9E-2A1A006F6452.jpg [View same] [iqdb] [saucenao] [google] >>28241088 Pomie…

>>	Anonymous Fri Jul 15 12:39:20 2022 No.28241329 >thumbnail card batlle vs Kagami shachou

>>	Anonymous Fri Jul 15 12:39:20 2022 No.28241330 File: 659 KB, 2667x4000, 1638650833838.jpg [View same] [iqdb] [saucenao] [google] >>28241160 But...I don't wish to die alone.

>>	Anonymous Fri Jul 15 12:39:30 2022 No.28241340 >>28241288 congrats! don't hurt yourself again dummy :(

>>	Anonymous Fri Jul 15 12:39:37 2022 No.28241348 >>28241088 That one and merman are on my list for sure. Excited for what Vampire is gonna be like.

>>	Anonymous Fri Jul 15 12:39:51 2022 No.28241358 Do we have any info on Selen and Enna baseball performance ?

>>	Anonymous Fri Jul 15 12:39:54 2022 No.28241364 This card battle is kino

>>	Anonymous Fri Jul 15 12:40:03 2022 No.28241373 >>28241348 I want angst, milord please...

>>	Anonymous Fri Jul 15 12:40:13 2022 No.28241381 >>28241288 pop a wheelie to check safety

>>	Anonymous Fri Jul 15 12:40:32 2022 No.28241397 File: 116 KB, 432x520, 1649939732690.jpg [View same] [iqdb] [saucenao] [google] >>28241348 HUH?

>>	Anonymous Fri Jul 15 12:40:48 2022 No.28241410 Shachou's thumbnails are something

>>	Anonymous Fri Jul 15 12:40:52 2022 No.28241412 >>28241329 Kino

>>	Anonymous Fri Jul 15 12:40:57 2022 No.28241417 mysta bath ASMR stream when

>>	Anonymous Fri Jul 15 12:40:58 2022 No.28241420 >>28241214 >>28241327 Sucking his cock under the table while he’s on a work phone call… him looking down at you and smirking because you’re just so cute with your mouth full of cock…

>>	Anonymous Fri Jul 15 12:41:00 2022 No.28241424 File: 247 KB, 1000x1000, 1647566601431.gif [View same] [iqdb] [saucenao] [google] >>28241340 ill be safe! >>28241381 ill do a rad wheelie!

>>	Anonymous Fri Jul 15 12:41:09 2022 No.28241434 File: 244 KB, 1727x1605, FXlqw-fXwAA7zi8.jpg [View same] [iqdb] [saucenao] [google] >>28241373 He said it was gonna be super angsty, I'm excited.

>>	Anonymous Fri Jul 15 12:41:11 2022 No.28241435 >>28241358 They'll be riding the bench the whole tourney sadly.

>>	Anonymous Fri Jul 15 12:41:12 2022 No.28241436 >>28241358 their coach hasn't started yet

>>	Anonymous Fri Jul 15 12:41:38 2022 No.28241450 >>28238918 Literally just hide the obvious bait posts. 4chan gives you the tools to do so. You are not obligated to engage in someone's else schizophrenia. I went through years of false-flagging, gore and cp posting for simply liking holostars.

>>	Anonymous Fri Jul 15 12:41:46 2022 No.28241453 File: 194 KB, 1600x1835, FUPw48-acAUEyZL.jpg [View same] [iqdb] [saucenao] [google] Please tell me if Millie's going to stream in less than two hours.

>>	Anonymous Fri Jul 15 12:41:59 2022 No.28241466 >>28241294 when i tuned in he was being menhera about being called onii chan and asking chat to do it for him and now hes calling klee his imouto

>>	Anonymous Fri Jul 15 12:42:16 2022 No.28241475 Funny to think that all these women fantasizing about being dommed by Vox are probably older than him.

>>	Anonymous Fri Jul 15 12:42:23 2022 No.28241479 >>28241373 It's ok sister, he said the angst is coming. >>28241348 Merman is more creative storytelling, Butler is just someone taking care of you

>>	Anonymous Fri Jul 15 12:42:31 2022 No.28241483 >>28241417 Mysta GFE stream when...

>>	Anonymous Fri Jul 15 12:42:56 2022 No.28241497 >>28241483 That's every stream

>>	Anonymous Fri Jul 15 12:43:04 2022 No.28241502 >>28241475 Not likely, I’m only 21

>>	Anonymous Fri Jul 15 12:43:15 2022 No.28241512 File: 139 KB, 512x512, 1629962616057.png [View same] [iqdb] [saucenao] [google] >>28241475 Women love young boy tho

>>	Anonymous Fri Jul 15 12:43:22 2022 No.28241516 >>28241434 Immortality has so much angst ans hurt/comfort potential, I can't wait!

>>	Anonymous Fri Jul 15 12:43:30 2022 No.28241521 >>28241475 Younger guy domming me UUOOOHHH

>>	Anonymous Fri Jul 15 12:43:30 2022 No.28241520 >>28241483 whenever he does another late stream, he always gets lonely and insecure in the evening

>>	Anonymous Fri Jul 15 12:44:14 2022 No.28241560 >>28241248 Girls like you wouldn't understand about Pomu, there's no single other weeb girl in the world who loves Japan and anime, used to cosplay at cons and posted their nudes online when they were young and dumb. She's a unique existence.

>>	Anonymous Fri Jul 15 12:44:17 2022 No.28241563 File: 6 KB, 439x514, 1657857328793 (3).jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Fri Jul 15 12:44:29 2022 No.28241575 Bros, when NijiEN will be no more later this year, are we all gonna move to /2434/ thread?

>>	Anonymous Fri Jul 15 12:44:33 2022 No.28241578 >>28241512 Didn't know you were awake elira

>>	Anonymous Fri Jul 15 12:44:51 2022 No.28241593 >>28241497 he’s being cute in every stream... especially in his zatsudan part of the stream... my cute menhera gf

>>	Anonymous Fri Jul 15 12:45:05 2022 No.28241601 >>28240861 Someone wrote about this already

>>	Anonymous Fri Jul 15 12:45:15 2022 No.28241610 >>28241512 >young boys h-how lewd ><

>>	Anonymous Fri Jul 15 12:45:15 2022 No.28241609 >thumbnail card battle vs Yashiro

>>	Anonymous Fri Jul 15 12:45:41 2022 No.28241625 >>28241294 I'm still salty about the kyoudai thing. I'll watch him again next week.

>>	Anonymous Fri Jul 15 12:45:53 2022 No.28241633 >>28241560 >posted their nudes online when they were young and dumb haha… I would never…

>>	Anonymous Fri Jul 15 12:46:02 2022 No.28241638 >>28241609 what stream is this

>>	Anonymous Fri Jul 15 12:46:04 2022 No.28241640 >>28241575 Nah I'm moving to wherever Pomu and Rosemi and Elira end up, don't care about Nijisanji.

>>	Anonymous Fri Jul 15 12:46:05 2022 No.28241641 Was Yashiro reading off of a script? kek

>>	Anonymous Fri Jul 15 12:46:15 2022 No.28241651 >>28241625 What bothers you about it?

>>	Anonymous Fri Jul 15 12:46:18 2022 No.28241655 >>28241638 natsume 3d

>>	Anonymous Fri Jul 15 12:46:34 2022 No.28241669 >>28241638 The ongoing 3D debut stream

>>	Anonymous Fri Jul 15 12:46:42 2022 No.28241672 >>28241560 >posted their nudes online when they were young and dumb if only you knew...

>>	Anonymous Fri Jul 15 12:46:44 2022 No.28241673 >>28241638 https://www.youtube.com/watch?v=1uKKrPccLo0

>>	Anonymous Fri Jul 15 12:46:48 2022 No.28241675 salaryman has a good voice

>>	Anonymous Fri Jul 15 12:46:52 2022 No.28241683 File: 237 KB, 2048x2048, FUVsaPjaIAEmA0l.jpg [View same] [iqdb] [saucenao] [google] >>28241479 I honestly don't have a specific preference for his asmrs, it's nice to see where he goes with them. Some are horny and some are comfy and I'm ok with that.

>>	Anonymous Fri Jul 15 12:47:00 2022 No.28241689 File: 260 KB, 759x670, _214535.jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Fri Jul 15 12:47:11 2022 No.28241698 >>28241640 Same. I hope they go to Twitch. Growth/networking as an Indie on YT sucks.

>>	Anonymous Fri Jul 15 12:47:17 2022 No.28241699 >>28241633 post yours and ill trade the ones i took when i was 14 and fit im a male

>>	Anonymous Fri Jul 15 12:47:19 2022 No.28241702 >>28241640 I mean they all will be merged with the main branch as EN won't be feasible anymore.

>>	Anonymous Fri Jul 15 12:47:21 2022 No.28241705 File: 240 KB, 1536x2048, 838D7173-D63A-4E04-9B86-2FEA5AA4593F.jpg [View same] [iqdb] [saucenao] [google] >>28241593 Mysta's zatsudans and SC readings are the best. Normalfags will never understand.

>>	Anonymous Fri Jul 15 12:47:27 2022 No.28241708 >>28241424 People were actually concerned for you yesterday anon, so do be careful.

>>	Anonymous Fri Jul 15 12:47:33 2022 No.28241713 File: 642 KB, 1129x635, 243827432348.png [View same] [iqdb] [saucenao] [google] I'll never have a duel against her...

>>	Anonymous Fri Jul 15 12:47:43 2022 No.28241722 File: 465 KB, 520x605, 1648669010206.png [View same] [iqdb] [saucenao] [google] >>28241689 sonny kimoi

>>	Anonymous Fri Jul 15 12:47:52 2022 No.28241730 >>28241672 >>28241633 wtf just how common this is?

>>	Anonymous Fri Jul 15 12:47:54 2022 No.28241734 >>28241655 >>28241669 thanks

>>	Anonymous Fri Jul 15 12:47:59 2022 No.28241737 Kagami shachou and Yashiro are built to be card game duel villains

>>	Anonymous Fri Jul 15 12:48:16 2022 No.28241751 >>28241699 I posted my tits and thighs in one of the Confess threads once.

>>	Anonymous Fri Jul 15 12:48:34 2022 No.28241759 >>28241689 keep him away from cunny, he's dangerous

>>	Anonymous Fri Jul 15 12:48:44 2022 No.28241770 If Pomu and Selen graduate and join other corpos or go indie, do you think they still will be friends ? I like their collabs

>>	Anonymous Fri Jul 15 12:48:44 2022 No.28241771 Isn't that a character from her LN? lol

>>	Anonymous Fri Jul 15 12:48:55 2022 No.28241777 File: 155 KB, 1591x1620, 1640125278997.jpg [View same] [iqdb] [saucenao] [google] >>28241708 i know, it was extremely heartwarming and i didnt know how to respond properly

>>	Anonymous Fri Jul 15 12:48:59 2022 No.28241781 Yashiro's dumb face always cracks me up

>>	Anonymous Fri Jul 15 12:49:01 2022 No.28241783 File: 38 KB, 662x611, FTR23JPaAAEBB-R.jpg [View same] [iqdb] [saucenao] [google] >>28241689 rapist

>>	Anonymous Fri Jul 15 12:49:14 2022 No.28241790 >>28241730 For extremely dumb girls who were raised by parents who don't care, very

>>	Anonymous Fri Jul 15 12:49:17 2022 No.28241792 >>28241699 You'd go to jail just to satisfy a fempedo? That's admirable.

>>	Anonymous Fri Jul 15 12:49:49 2022 No.28241820 >>28241689 Elira....

>>	Anonymous Fri Jul 15 12:49:52 2022 No.28241821 >>28241770 Blood sisters will never die. They're really close, doubt they'll ignore each other if they do leave NijiEN.

>>	Anonymous Fri Jul 15 12:50:02 2022 No.28241825 >>28241737 >old men are dangerous duh

>>	Anonymous Fri Jul 15 12:50:15 2022 No.28241834 >thumbnail card battle vs Chaika part 2

>>	Anonymous Fri Jul 15 12:50:19 2022 No.28241837 >tutorial guy is the final boss Kino

>>	Anonymous Fri Jul 15 12:50:24 2022 No.28241842 Bros, why Holos copied Niji's idea of giving an idiotic names to their waves/gens?

>>	Anonymous Fri Jul 15 12:50:54 2022 No.28241870 I wanna play this card game Probably better than yugioh

>>	Anonymous Fri Jul 15 12:50:54 2022 No.28241871 Wave 6/Tempus please give us a chaika chuuba...

Anonymous Fri Jul 15 12:51:08 2022 No.28241881

>>28241651
I just liked the term and them calling each other kyoudai. I respect and understand Yugo's wishes and I agree (particularly with the mommy/daddy thing) that it needed to stop. I just didn't think the kyoudai thing had to go too. I know that it's just for him, and that fanworks or the others can still use it etc, but it just left me salty. It's just a little pet peeve I guess, and I'll watch and support him. Also doesn't help he's streaming Genshin which I hate.

>>	Anonymous Fri Jul 15 12:51:27 2022 No.28241900 >>28241870 Kuzuha thumbnail card deck...

>>	Anonymous Fri Jul 15 12:51:32 2022 No.28241905 >>28241871 Vox is chaika EN

>>	Anonymous Fri Jul 15 12:51:58 2022 No.28241923 File: 331 KB, 1129x629, 5943854385.png [View same] [iqdb] [saucenao] [google]

>>	Anonymous Fri Jul 15 12:52:11 2022 No.28241930 HEART OF THE THUMBNAILS

>>	Anonymous Fri Jul 15 12:52:14 2022 No.28241931 >>28241923 i can't read

>>	Anonymous Fri Jul 15 12:52:27 2022 No.28241941 >>28241900 Consistency makes for a good deck

>>	Anonymous Fri Jul 15 12:52:39 2022 No.28241955 >>28241842 they didn't, giving shit retarded names is just japanese culture

>>	Anonymous Fri Jul 15 12:52:55 2022 No.28241968 >>28241842 only for their male gens the female gens still use the hl prefix

>>	Anonymous Fri Jul 15 12:53:20 2022 No.28241985 >using the current stream's thumbnail as the finisher pottery

>>	Anonymous Fri Jul 15 12:53:26 2022 No.28241988 I want wave 6 to be chef themed where all the livers do cooking streams frequently and every month do a cooking versus collab. Basically just vtuber iron chef.

>>	Anonymous Fri Jul 15 12:53:35 2022 No.28241991 >>28241900 Depends on how strong his one thumbnail is.

>>	Anonymous Fri Jul 15 12:53:41 2022 No.28241996 >>28241931 Same, Millie

>>	Anonymous Fri Jul 15 12:53:51 2022 No.28242007 WIN EACH OTHER

>>	Anonymous Fri Jul 15 12:54:02 2022 No.28242011 Who are (You) watching right now ?

>>	Anonymous Fri Jul 15 12:54:28 2022 No.28242028 >>28241988 kino stream idea noted

>>	Anonymous Fri Jul 15 12:54:34 2022 No.28242034 >WIN EACH OTHER KINOOOOOOOOOO

>>	Anonymous Fri Jul 15 12:54:51 2022 No.28242048 >>28242011 ewiwa's RE2 vod

>>	Anonymous Fri Jul 15 12:55:01 2022 No.28242050 >>28242011 watching pomu vods of course

>>	Anonymous Fri Jul 15 12:55:06 2022 No.28242055 >>28242011 Seffyna and Natsume

>>	Anonymous Fri Jul 15 12:55:09 2022 No.28242059 >>28241931 >cute laughing voice >ganbatte >natsume is good at drawing >nicely energetic! >good voice >nijisanji (proper)

>>	Anonymous Fri Jul 15 12:55:24 2022 No.28242071 >>28242011 natsume and ichigo

>>	Anonymous Fri Jul 15 12:55:25 2022 No.28242072 RIKU?!

>>	Anonymous Fri Jul 15 12:55:30 2022 No.28242077 >>28242011 Seffyna

>>	Anonymous Fri Jul 15 12:55:40 2022 No.28242088 Rikkun!?

>>	Anonymous Fri Jul 15 12:55:40 2022 No.28242087 Is that Tazumi's voice?

>>	Anonymous Fri Jul 15 12:55:43 2022 No.28242090 >>28242011 tf2 sonny vod

>>	Anonymous Fri Jul 15 12:55:51 2022 No.28242098 Voice of god

>>	Anonymous Fri Jul 15 12:55:55 2022 No.28242101 >>28241988 Hello is there some nijistaff lurking here? Quick take a note and make it a new NijiProgram

>>	Anonymous Fri Jul 15 12:56:03 2022 No.28242107 I thought she was going to have a thumbnail card battle vs Riku Tazumi

>>	Anonymous Fri Jul 15 12:56:12 2022 No.28242113 File: 3.37 MB, 360x360, FA845FA6-46BD-4605-B9B8-431D457DFC66.gif [View same] [iqdb] [saucenao] [google] >>28241988 Dagoth Ur for wave 6

>>	Anonymous Fri Jul 15 12:56:25 2022 No.28242122 Natsume just met god

Anonymous Fri Jul 15 12:56:48 2022 No.28242136
File: 463 KB, 573x478, file.png [View same] [iqdb] [saucenao] [google]

reminder Reimoo's cover is premiering in 4 minutes. do yourself a favor and check out one of the best singers in NijiEn. for you schizos. I said one of, not that she's the best.
https://www.youtube.com/watch?v=qFzujolpZ8c
https://www.youtube.com/watch?v=qFzujolpZ8c
https://www.youtube.com/watch?v=qFzujolpZ8c

>>	Anonymous Fri Jul 15 12:56:49 2022 No.28242138 https://www.youtube.com/watch?v=qFzujolpZ8c Reimu's cover premiere

>>	Anonymous Fri Jul 15 12:57:19 2022 No.28242161 >>28242011 Paprika

>>	Anonymous Fri Jul 15 12:57:21 2022 No.28242162 >>28242136 >>28242138 now kiss

>>	Anonymous Fri Jul 15 12:57:24 2022 No.28242164 >>28242090 still crazy that you can say that and it's not doxfaggotry

>>	Anonymous Fri Jul 15 12:57:49 2022 No.28242180 who's the other her?

>>	Anonymous Fri Jul 15 12:58:02 2022 No.28242188 >>28242164 the timeline we are in is surreal

>>	Anonymous Fri Jul 15 12:58:09 2022 No.28242194 File: 265 KB, 2048x2036, FW1da3JUIAAOoyY.jpg [View same] [iqdb] [saucenao] [google] >>28242136 Good luck Reimu.

>>	Anonymous Fri Jul 15 12:58:15 2022 No.28242201 >>28242180 Mashiro

>>	Anonymous Fri Jul 15 12:58:32 2022 No.28242221 solo turing love.... nachume...

>>	Anonymous Fri Jul 15 12:58:38 2022 No.28242227 >>28242164 It was really cute, you could tell he loves the game. I hope his plans of more tf2 collabs come through, or even the mengen.

>>	Anonymous Fri Jul 15 12:58:38 2022 No.28242228 >>28242136 >best singers It's over ghostling, I'm Reimu anti now

>>	Anonymous Fri Jul 15 12:58:45 2022 No.28242232 waymoo

>>	Anonymous Fri Jul 15 12:59:04 2022 No.28242249 >>28242188 imagine if he makes a compilation of all his kills in that stream

>>	Anonymous Fri Jul 15 12:59:11 2022 No.28242255 >>28242164 His vod comments are bad.

Anonymous Fri Jul 15 12:59:41 2022 No.28242277
File: 1.00 MB, 1080x1527, 1648715841761.jpg [View same] [iqdb] [saucenao] [google]

>>28241248
>>28241560
I don't think pomudachis are interested in Pomu for what she was 15 years ago. We like Pomu because she grew into a good person and didn't just fall into drugs and depression or get babytrapped by some ugly fat loser like the other burnt out cosplay thots from that era.

But most importantly she doesn't look at her fans and fellow weebs with contempt the way most of those "weeb girls" do. She's genuinely enthusiastic when it comes to talking about anime and manga and her experiences in Japan. She doesn't automatically judge someone as a creep just because they like a certain anime or enjoy masturbating to JAVs. Trying to befriend women in the western anime fandom is like navigating through a minefield of traps just so you don't offend them because they all have extremely specific views of what weeb content is "acceptable to like" and feel very strongly about it.

I don't know why women get so offended that Pomudachis see Pomu as unique. If her personality is really that common then why have seemingly all of us never encountered someone like her before? Makes no sense. I think what's more likely is a lot of women just don't understand how hurtful it is to have your hobbies belittled constantly even by those who pretend to be your comrades. Pomu makes so many men feel at home just by watching her streams and listening to her ramble on about her hobbies. The sincere joy she shows when having a conversation with her chat about obscure 00's anime or dumb adventures in Japan or even visiting soaplands is really fucking cute and endearing.

If you can find me another woman like Pomu I'd gladly give her a chance, I'm not a misogynist, but I just don't want to be hurt by someone that will treat me like shit for daring to like Saya no Uta or some shit.

>>	Anonymous Fri Jul 15 13:00:02 2022 No.28242290 mysta playing mysta simulator https://www.youtube.com/watch?v=akx6w9zlQBI

>>	Anonymous Fri Jul 15 13:00:03 2022 No.28242291 >>28242255 not as bad as Shu. every comment and sentence has emotes.

>>	Anonymous Fri Jul 15 13:00:31 2022 No.28242314 File: 185 KB, 1013x1031, FXtSUniaMAAq1M9.jpg [View same] [iqdb] [saucenao] [google] artists are fast

>>	Anonymous Fri Jul 15 13:00:32 2022 No.28242315 >>28242136 >>28242138 starting

>>	Anonymous Fri Jul 15 13:00:47 2022 No.28242329 fucking premiere countdown music scared me jesus christ

>>	Anonymous Fri Jul 15 13:00:59 2022 No.28242339 I want to thank Selen for organizing a lot of world collabs, without them Miya and nagao doign stuff with en and this tf2 collab would probably never happen

>>	Anonymous Fri Jul 15 13:01:00 2022 No.28242341 >>28242136 STARTING!

>>	Anonymous Fri Jul 15 13:01:02 2022 No.28242344 >>28242277 coggers

>>	Anonymous Fri Jul 15 13:01:02 2022 No.28242343 >>28242277 Yeah, this is why Pomudachi aren't getting any boob pics.

>>	Anonymous Fri Jul 15 13:01:09 2022 No.28242348 File: 91 KB, 1004x316, IMG_20220420_153522.jpg [View same] [iqdb] [saucenao] [google] >>28242277

>>	Anonymous Fri Jul 15 13:01:09 2022 No.28242349 why is the premier music scary wtf

>>	Anonymous Fri Jul 15 13:01:14 2022 No.28242355 BUY NACHUME'SBOOK

>>	Anonymous Fri Jul 15 13:01:20 2022 No.28242361 Manga adaptation holy shit

>>	Anonymous Fri Jul 15 13:01:22 2022 No.28242365 The LN MC looks so generic

>>	Anonymous Fri Jul 15 13:01:24 2022 No.28242368 what on earth are these premiere trailers

>>	Anonymous Fri Jul 15 13:01:26 2022 No.28242370 My wife (male) is starting his second stream today! https://www.youtube.com/watch?v=akx6w9zlQBI

>>	Anonymous Fri Jul 15 13:01:31 2022 No.28242374 https://www.youtube.com/watch?v=qFzujolpZ8c PLEASE WATCH MILLIE'S FRIEND REIMU'S FIRST COVER SHE WORKED VERY HARD ON IT AND MILLIE WOULD REALLY APPRECIATE IT IF YOU'D GIVE IT A WATCH THANK YOU

>>	Anonymous Fri Jul 15 13:01:39 2022 No.28242381 i hate honeyworks but i hope this is good

>>	Anonymous Fri Jul 15 13:01:45 2022 No.28242385 File: 172 KB, 1111x1181, 1654521883450.jpg [View same] [iqdb] [saucenao] [google] GOD WHY DOESN"T REIMU DO MORE KARAOKE SHES SO GOOD AT SINGING

>>	Anonymous Fri Jul 15 13:01:54 2022 No.28242392 File: 41 KB, 200x200, 1642847232717.png [View same] [iqdb] [saucenao] [google] >>28242277

>>	Anonymous Fri Jul 15 13:02:05 2022 No.28242401 >>28242011 Too depressed to watch anything. Aruvn most likely going to sharts while wave 6 most likely to get 5 more boring and untalented fujobaits.

>>	Anonymous Fri Jul 15 13:02:10 2022 No.28242408 almost doesn't sound like her

>>	Anonymous Fri Jul 15 13:02:10 2022 No.28242407 she sounds so cute

>>	Anonymous Fri Jul 15 13:02:19 2022 No.28242419 SHES SO CUUUUUUUUTE

>>	Anonymous Fri Jul 15 13:02:41 2022 No.28242430 Reimu-chan CUTE

>>	Anonymous Fri Jul 15 13:02:50 2022 No.28242437 It's her, I can still hear her SPICY LATINA vocals through the weeb lyrics.

>>	Anonymous Fri Jul 15 13:02:50 2022 No.28242439 File: 468 KB, 1405x2730, FXj_3IOVsAAeT8b.jpg [View same] [iqdb] [saucenao] [google] cute reimu i'll oshi you

>>	Anonymous Fri Jul 15 13:02:51 2022 No.28242440 >>28242361 Well, at least that has a better chance of being translated than the novel.

>>	Anonymous Fri Jul 15 13:02:58 2022 No.28242451 >>28242408 its Reimu forma del Nippon

>>	Anonymous Fri Jul 15 13:03:04 2022 No.28242457 Hold on, I missed something Is she making illustrations for a LN?

>>	Anonymous Fri Jul 15 13:03:16 2022 No.28242463 Holy shit Reimu's voice.....

>>	Anonymous Fri Jul 15 13:03:18 2022 No.28242465 She sounds like a marshmallow taste

>>	Anonymous Fri Jul 15 13:03:24 2022 No.28242470 Weimu extra cute everyday wtf

>>	Anonymous Fri Jul 15 13:03:43 2022 No.28242486 >>28242457 she wrote a LN BUY HER BOOK

>>	Anonymous Fri Jul 15 13:03:47 2022 No.28242489 >>28242465 She does, you're right

>>	Anonymous Fri Jul 15 13:03:50 2022 No.28242493 Reimu's sounds like a native Japanese. It's like I'm listening to an Anime opening.

>>	Anonymous Fri Jul 15 13:03:53 2022 No.28242495 >>28242457 Her published LN is getting a manga adaptation

>>	Anonymous Fri Jul 15 13:03:58 2022 No.28242502 maybe its time to oshi reimu...

>>	Anonymous Fri Jul 15 13:03:59 2022 No.28242503 >Do my best as an Idol oh no no no

>>	Anonymous Fri Jul 15 13:04:03 2022 No.28242507 >>28242457 She's a published LN author and her LN is getting a manga adaptation.

>>	Anonymous Fri Jul 15 13:04:14 2022 No.28242518 extra cute extra spicy

Anonymous Fri Jul 15 13:04:14 2022 No.28242519
File: 102 KB, 1940x1080, 9D61ABD2-F820-42CC-870E-7FDF4FB8A047.jpg [View same] [iqdb] [saucenao] [google]

>>28242277
>I think what's more likely is a lot of women just don't understand how hurtful it is to have your hobbies belittled constantly
Nigger, are we using the same board? Just posting a male can break a thread into a war. Getting called "fujoshart" is a daily occurrence. Hell it's not even isolated to this board.

>>	Anonymous Fri Jul 15 13:04:22 2022 No.28242521 File: 102 KB, 1044x1141, 1648562747729.jpg [View same] [iqdb] [saucenao] [google] DARKNESS IMPRISONING ME ALL THAT I SEE ABSOLUTE HORROR I CANNOT LIVE I CANNOT DIE TRAPPED IN MY SOUL PLEASE GOD WAKE ME GOD WAKE ME YEAAAAAAAAAAAAAAAAAAAAAAA

>>	Anonymous Fri Jul 15 13:04:28 2022 No.28242524 >>28242457 she wrote the LN, its getting a manga

>>	Anonymous Fri Jul 15 13:04:40 2022 No.28242534 Ike mixing songs again

>>	Anonymous Fri Jul 15 13:04:40 2022 No.28242533 File: 13 KB, 612x91, 1637288447525.png [View same] [iqdb] [saucenao] [google] dorky penguin

>>	Anonymous Fri Jul 15 13:04:47 2022 No.28242540 >>28242486 >>28242495 >>28242507 Oh, nice! Thanks anons.

>>	Anonymous Fri Jul 15 13:04:51 2022 No.28242542 bros, let me tell you she's extra spicy AND extra cute today.

>>	Anonymous Fri Jul 15 13:05:02 2022 No.28242554 REIMOOOOOOO I LOVE YOOOUUU

>>	Anonymous Fri Jul 15 13:05:10 2022 No.28242563 >>28242486 Is there a digital version at least? Don't want to get fucked in the ass by shipping.

>>	Anonymous Fri Jul 15 13:05:12 2022 No.28242564 rate the cover

>>	Anonymous Fri Jul 15 13:05:15 2022 No.28242566 cute

>>	Anonymous Fri Jul 15 13:05:33 2022 No.28242577 THAT WAS CUTE. RELEASE MORE COVER REIMUUUUU

>>	Anonymous Fri Jul 15 13:05:36 2022 No.28242581 this is actually a good cover nice. Too bad that it will never get the views it deserves

>>	Anonymous Fri Jul 15 13:05:48 2022 No.28242589 I wouldn't mind if Mysta delayed...

>>	Anonymous Fri Jul 15 13:05:53 2022 No.28242593 Don't care about the song but that was cute

>>	Anonymous Fri Jul 15 13:05:54 2022 No.28242595 I rate it 10/10 but I'm a weeb

>>	Anonymous Fri Jul 15 13:06:12 2022 No.28242614 >>28242277 >I think what's more likely is a lot of women just don't understand how hurtful it is to have your hobbies belittled constantly Are we living in the same reality? Women's hobbies and media get belittled all the time.

>>	Anonymous Fri Jul 15 13:06:13 2022 No.28242617 File: 162 KB, 585x564, 1644161502925.png [View same] [iqdb] [saucenao] [google] I ended up watching clips. I didn't know Shu was utterly oblivious to Pomu trying to kill him in Amongus.

>>	Anonymous Fri Jul 15 13:06:18 2022 No.28242620 The song sucks but the lyrics fit her to a tee, probably why she chose it.

>>	Anonymous Fri Jul 15 13:06:19 2022 No.28242621 >>28242581 If only she had a penis

>>	Anonymous Fri Jul 15 13:06:20 2022 No.28242622 >>28242564 cute/10

>>	Anonymous Fri Jul 15 13:06:22 2022 No.28242623 weimu kawae

>>	Anonymous Fri Jul 15 13:06:26 2022 No.28242628 File: 995 KB, 2048x2048, FW1ZN85acAEv_yv.jpg [View same] [iqdb] [saucenao] [google] I really liked this cover. Reimu did an amazing job, Ike didn't ruin it and it all works. Thank you Reimu and Ike.

>>	Anonymous Fri Jul 15 13:06:56 2022 No.28242652 The Reimu art from her cover looks better than her actual model. She really needs a 2.0 upgrade

>>	Anonymous Fri Jul 15 13:07:06 2022 No.28242657 does anyone know if she sang this song in karaoke before?

>>	Anonymous Fri Jul 15 13:07:07 2022 No.28242659 I can't begin to understand why singing isn't the core of Reimu's content.

>>	Anonymous Fri Jul 15 13:07:13 2022 No.28242667 turing love cover when

>>	Anonymous Fri Jul 15 13:07:29 2022 No.28242690 >>28242659 Perfectionism.

>>	Anonymous Fri Jul 15 13:07:32 2022 No.28242694 >>28242255 Not really, could have been worse. No namedrops from what I've read. Most egregious would probably be the "He's back, bros" and "If you know you know" comment

>>	Anonymous Fri Jul 15 13:07:32 2022 No.28242695 >>28242564 cute latina ghost/10 i wish the volume of her voice was turned up just a tiny bit more in the mix, it felt like she got drowned in the bass in some parts. she sounds really good though

>>	Anonymous Fri Jul 15 13:07:47 2022 No.28242710 Cover was decent. Kind of wish she picked a harder song though.

>>	Anonymous Fri Jul 15 13:07:52 2022 No.28242713 >>28242314 I like it when artist portrait sonny's face as the rapist that he is.

>>	Anonymous Fri Jul 15 13:07:53 2022 No.28242714 >>28242667 turing love is so overdone already anon, let it go...

>>	Anonymous Fri Jul 15 13:08:03 2022 No.28242720 >>28242617 anon... that was months ago...

>>	Anonymous Fri Jul 15 13:08:05 2022 No.28242721 File: 60 KB, 439x440, 1641600305816.jpg [View same] [iqdb] [saucenao] [google] unexpectedly super cute and sounds amazing. she should do more covers...

>>	Anonymous Fri Jul 15 13:08:39 2022 No.28242747 This marks the beginning of rei-domination

>>	Anonymous Fri Jul 15 13:08:47 2022 No.28242757 File: 214 KB, 1300x1300, Squee.jpg [View same] [iqdb] [saucenao] [google] Good cover from reimu I enjoyed it very much. I wonder why she hasn't done more of it when it's clearly her strong suite

>>	Anonymous Fri Jul 15 13:09:25 2022 No.28242789 >>28242757 Cursed luck, she kept bumping into problems one after another

>>	Anonymous Fri Jul 15 13:09:26 2022 No.28242793 File: 256 KB, 674x769, 1633900595181.jpg [View same] [iqdb] [saucenao] [google] >>28242721 She's got like 5~ already done, just stuck in permissions hell because management sees her as low priority

>>	Anonymous Fri Jul 15 13:09:27 2022 No.28242795 Holy kek is this game Mysta's playing

>>	Anonymous Fri Jul 15 13:09:38 2022 No.28242807 File: 81 KB, 500x500, 1651948304193.png [View same] [iqdb] [saucenao] [google] >>28242714 I won't stop until I get that Sonny and Petra Turing Love cover

>>	Anonymous Fri Jul 15 13:09:41 2022 No.28242814 funny bunny woooo

>>	Anonymous Fri Jul 15 13:10:04 2022 No.28242830 >>28242720 Yeah, I only watched Pomu's point of view.

>>	Anonymous Fri Jul 15 13:10:18 2022 No.28242842 >>28242564 very very cute/10

>>	Anonymous Fri Jul 15 13:10:20 2022 No.28242844 >>28242793 I'm sorry, Reimu Hope you get your permissions!

>>	Anonymous Fri Jul 15 13:10:23 2022 No.28242848 File: 27 KB, 347x347, 1634318759270.jpg [View same] [iqdb] [saucenao] [google] >>28242314 didnt plan on watching that stream but i need context behind this fanart...

>>	Anonymous Fri Jul 15 13:10:27 2022 No.28242852 I really liked the cover, not a fan of the song but Reimu pulled it off really nicely as it was cute as fuck

>>	Anonymous Fri Jul 15 13:10:39 2022 No.28242863 reimu, I know you're /here/ good fucking job

>>	Anonymous Fri Jul 15 13:11:02 2022 No.28242877 Mysta can't ride a bike...

>>	Anonymous Fri Jul 15 13:11:10 2022 No.28242883 >>28242793 Reimu you deserve better, but at least you're not giving up.

>>	Anonymous Fri Jul 15 13:11:14 2022 No.28242887 >>28242314 i would rape alban in this image

>>	Anonymous Fri Jul 15 13:11:15 2022 No.28242889 >>28242814 Has anyone in EN sang a the pillows song?

>>	Anonymous Fri Jul 15 13:11:21 2022 No.28242897 >>28242617 My maidenless by choice, Shumaid, is a dense not by choice

>>	Anonymous Fri Jul 15 13:11:51 2022 No.28242924 https://twitter.com/ike_eveland/status/1547929096214065153 A scheduled tweet is still a tweet... I guess...

>>	Anonymous Fri Jul 15 13:12:01 2022 No.28242938 >>28242659 This >>28242690 but also perms fucked her over. Same with Ike.

>>	Anonymous Fri Jul 15 13:12:24 2022 No.28242950 >>28242848 Using a sonny avatar and not watching every sonny streams ? Pathetic.

>>	Anonymous Fri Jul 15 13:12:35 2022 No.28242962 >>28242852 yeah i usually hate cute songs but she did great. more covers please.

Anonymous Fri Jul 15 13:13:04 2022 No.28242991
File: 184 KB, 311x363, 1653962842730.png [View same] [iqdb] [saucenao] [google]

>>28242343
>>28242344
>>28242348
>>28242392
fuck you guys

>>28242519
>>28242614
Sorry if I'm wrong about that. Don't know why girls can't see Pomu's charm though if you realize how precious it is to have someone acknowledge and appreciate your interests without judgement.

>>	Anonymous Fri Jul 15 13:13:12 2022 No.28242996 where can I find a millie parfait gf

>>	Anonymous Fri Jul 15 13:13:26 2022 No.28243006 File: 2.63 MB, 1920x1080, Screenshot_1.png [View same] [iqdb] [saucenao] [google] I have no idea what I'm watching

>>	Anonymous Fri Jul 15 13:13:54 2022 No.28243035 File: 29 KB, 383x384, 1650531351299.jpg [View same] [iqdb] [saucenao] [google] >>28242950 im sorry! ill do better and channel my inner neet next time...

>>	Anonymous Fri Jul 15 13:14:03 2022 No.28243043 >>28242277 Are you the same Pomudachi that was saying girls are all vapid NPCs because they aren't interested in dinosaurs, mecha and space when she was playing 5 dates?

>>	Anonymous Fri Jul 15 13:14:12 2022 No.28243054 File: 10 KB, 516x100, 1638881275699.png [View same] [iqdb] [saucenao] [google] Reimu.... I like the cover, Ike's mixing is a bit too overproduced but her voice is really cute.

>>	Anonymous Fri Jul 15 13:14:23 2022 No.28243067 >>28242807 man I really want to hear it. Petra's cute high voice and Sonny's low voice and they could mix it up with Peter singing and Sonny going higher

>>	Anonymous Fri Jul 15 13:14:30 2022 No.28243072 I want someone to cover this song https://m.youtube.com/watch?v=4vmuNoy0pCo

>>	Anonymous Fri Jul 15 13:14:33 2022 No.28243075 >>28243006 Every youtube video in 2014

>>	Anonymous Fri Jul 15 13:14:40 2022 No.28243078 >>28242996 easier to find a millie parfait bf

>>	Anonymous Fri Jul 15 13:15:04 2022 No.28243102 reimu's cover hit different with subs turned on.

>>	Anonymous Fri Jul 15 13:15:34 2022 No.28243128 wherr can i get a gf

>>	Anonymous Fri Jul 15 13:15:36 2022 No.28243130 >>28243006 Goat Simulator is unironically fun as fuck

>>	Anonymous Fri Jul 15 13:15:36 2022 No.28243131 File: 324 KB, 1754x1240, 3169ED6F-11E0-4DC5-89D3-74ADE9DEEC61.jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Fri Jul 15 13:15:58 2022 No.28243149 File: 453 KB, 2048x2048, 05A70F72-16F7-45F9-8E73-DF487BEA7C5D.jpg [View same] [iqdb] [saucenao] [google] >Search Finana >Only 3 results >2 are links to her twitter the third is a ritual post What happened? Can I talk about Feesh?

>>	Anonymous Fri Jul 15 13:16:05 2022 No.28243156 >>28243128 not here pomudachi

>>	Anonymous Fri Jul 15 13:16:22 2022 No.28243165 >>28243149 did you do your homework first?

>>	Anonymous Fri Jul 15 13:16:23 2022 No.28243167 >>28242277 women here post about their weird rape incest animal crushing pregnancy fantasies, i think there's more than a few women who won't judge you for your weird shit

>>	Anonymous Fri Jul 15 13:16:41 2022 No.28243181 reimu's singing voice in japanese is cute

>>	Anonymous Fri Jul 15 13:16:50 2022 No.28243194 >>28243072 I heard that Mashiro did a cover for that song. You should check it out.

Anonymous Fri Jul 15 13:16:55 2022 No.28243200
File: 640 KB, 2062x2751, 1657011006540.jpg [View same] [iqdb] [saucenao] [google]

>>28242996
>where can I find a millie parfait gf
The average filipina is literally Millie.
Just feed her ice cream and sit her down to watch anime after she comes back from work and you'll turn her into Millie in less than a year

>>28243078
so true

>>	Anonymous Fri Jul 15 13:17:14 2022 No.28243217 File: 59 KB, 282x141, 1630729744580.png [View same] [iqdb] [saucenao] [google] >>28243149 Educate yourself and find out anon.

>>	Anonymous Fri Jul 15 13:17:28 2022 No.28243223 >>28242996 try flipland?

>>	Anonymous Fri Jul 15 13:17:42 2022 No.28243237 >>28243149 go ahead. there's just a lot of bait about her right now

>>	Anonymous Fri Jul 15 13:17:42 2022 No.28243238 File: 234 KB, 394x394, 1628035500522.png [View same] [iqdb] [saucenao] [google] >>28243067 that and roki with yugo please

>>	Anonymous Fri Jul 15 13:17:48 2022 No.28243246 >>28242713 Speaking of Sonny looking like a rapist...Sonny molesting Alban! https://poipiku.com/5220826/7122129.html

>>	Anonymous Fri Jul 15 13:17:58 2022 No.28243256 File: 88 KB, 474x473, 1656863266852.jpg [View same] [iqdb] [saucenao] [google] >>28243149 Just talk about Finana dood.

>>	Anonymous Fri Jul 15 13:18:01 2022 No.28243263 >>28243200 Jesus Christ are those real?

>>	Anonymous Fri Jul 15 13:18:14 2022 No.28243281 >>28243200 Bro those milkers.

>>	Anonymous Fri Jul 15 13:18:21 2022 No.28243290 File: 369 KB, 890x890, 1643585324346.png [View same] [iqdb] [saucenao] [google] >>28243200 >sex goddess on the right

>>	Anonymous Fri Jul 15 13:18:26 2022 No.28243294 >>28242924 H-how did you know it's a scheduled tweet? Also, fellow quilldren, we just got nijiscenario crumbs today... we can survive this... let the man slep...

>>	Anonymous Fri Jul 15 13:18:39 2022 No.28243303 File: 3.12 MB, 2067x3486, IMG_20220711_022525.jpg [View same] [iqdb] [saucenao] [google] reimu's cover was so cute

Anonymous Fri Jul 15 13:18:43 2022 No.28243309
File: 1.20 MB, 971x560, file.png [View same] [iqdb] [saucenao] [google]

damn it why couldn't it have been petra or selen?
we could have had Lazulight vs Obsydia
I really wish management didn't force them to interact with Uki, it's always Uki, why they have to always place him in collabs as the only male?
fucking dumb

>>	Anonymous Fri Jul 15 13:18:46 2022 No.28243313 File: 28 KB, 830x128, 1657343182951.png [View same] [iqdb] [saucenao] [google] >>28243246 Why do they make things so difficult...

>>	Anonymous Fri Jul 15 13:19:02 2022 No.28243329 >>28243149 You can always talk about Finana! Whenever you see my ritual post know that a ryuguard is lurking

>>	Anonymous Fri Jul 15 13:19:08 2022 No.28243337 >>28243131 god these uniforms are so...

>>	Anonymous Fri Jul 15 13:19:22 2022 No.28243349 File: 1.54 MB, 370x400, 1653737654231.gif [View same] [iqdb] [saucenao] [google] >>28243200 God fucking damn it, both these creatures deserve the ojisan correction. UUOOOOHHH

Anonymous Fri Jul 15 13:19:34 2022 No.28243362
File: 442 KB, 495x635, 1629875588817.png [View same] [iqdb] [saucenao] [google]

>>28243043
No but if a person isn't at least slightly interested in archaeology or technology or outer space something must be wrong with them I think. Like all human progress has been inspired by the desire to seek out the unknown and learn about it, it's fascinating.

>>28243167
You'd think so but that's what makes it so frustrating. You can have a long conversation with a woman about her weird degenerate hobbies because you just enjoy listening to her talk about animal crushing or rape fantasies or guro or whatever but the moment you ask her to watch Made in Abyss with you she freaks out and calls you a pedophile because only her weird interests are OK. I've experienced this so many times I don't bother trying to connect with girls anymore.

>>	Anonymous Fri Jul 15 13:20:11 2022 No.28243393 >>28243309 >>28243313 in women's mind, they like hanging out with non threatening and flirty males which is why homos are like girl accessories some time

>>	Anonymous Fri Jul 15 13:20:14 2022 No.28243394 >>28243294 It's a promo tweet posted right on the dot, and he hasn't had any other activity since yesterday. He also wasn't there for Reimu's premiere, and if he was available he wouldn't have missed it.

>>	Anonymous Fri Jul 15 13:20:44 2022 No.28243415 >>28242628 Reimu didn't even pay Ike for his work except by SC

>>	Anonymous Fri Jul 15 13:20:48 2022 No.28243422 File: 416 KB, 1440x1440, 1657074797324.jpg [View same] [iqdb] [saucenao] [google] >>28243263 >>28243281 >>28243290

>>	Anonymous Fri Jul 15 13:20:48 2022 No.28243420 >>28243362 At least you've talked to girls. Last time I've talked with one was before the pandemic started

>>	Anonymous Fri Jul 15 13:20:55 2022 No.28243429 >>28243035 You better be. Can't be too easy with the kinds of you

>>	Anonymous Fri Jul 15 13:20:59 2022 No.28243434 >>28243393 you fucking nigger i thought this reply would be the answer

>>	Anonymous Fri Jul 15 13:21:26 2022 No.28243471 >>28243149 you're always welcome to talk about your oshi anon, most ryuguards probably left for discord or are lurking.

>>	Anonymous Fri Jul 15 13:21:44 2022 No.28243494 File: 1.24 MB, 1500x1200, FXnsSPpVsAE_C9E.jpg [View same] [iqdb] [saucenao] [google] >>28243415 Did you watch Ike's stream? He doesn't want any money from her.

>>	Anonymous Fri Jul 15 13:21:51 2022 No.28243501 >>28243313 it's 355yes

>>	Anonymous Fri Jul 15 13:21:59 2022 No.28243508 File: 382 KB, 833x199, Screenshot_1.png [View same] [iqdb] [saucenao] [google] The game knows.

>>	Anonymous Fri Jul 15 13:22:03 2022 No.28243514 File: 272 KB, 689x2048, 7DA93EDE-EF28-483D-ABFB-EB189434EABB.jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Fri Jul 15 13:22:04 2022 No.28243515 File: 64 KB, 650x702, 1627946410345.jpg [View same] [iqdb] [saucenao] [google] >>28243422 BIG MOMMY MILKERS

>>	Anonymous Fri Jul 15 13:22:13 2022 No.28243522 >>28243362 You are the same pomudachi.

>>	Anonymous Fri Jul 15 13:22:17 2022 No.28243526 >>28243422 You can see her bra through the blouse, fuck

Anonymous Fri Jul 15 13:22:44 2022 No.28243560
File: 338 KB, 1742x2048, 1626705322341.jpg [View same] [iqdb] [saucenao] [google]

>>28243072
i'm glad to hear this again, i should really archive all of the stuff i listen to. so many vtuber songs i liked have vanished due to terminated accounts or randomly privated videos

>>	Anonymous Fri Jul 15 13:22:53 2022 No.28243568 >>28243422 I prefer the chink at the back

>>	Anonymous Fri Jul 15 13:22:57 2022 No.28243574 >>28243501 Thank you! I'm too lazy to do math.

>>	Anonymous Fri Jul 15 13:23:06 2022 No.28243580 File: 208 KB, 765x2048, EA552E2E-F7FE-4004-9878-D62CAA15E50F.jpg [View same] [iqdb] [saucenao] [google] >>28243514

>>	Anonymous Fri Jul 15 13:23:20 2022 No.28243588 >>28243422 Stitch work on the hat is garbage, but I respect the grind

>>	Anonymous Fri Jul 15 13:23:41 2022 No.28243608 >>28243149 I think Finana is cute! Besides my oshi, she's the only one i watch when she does supa reading or zatsudan, it's so cute and comfy. I like both her feesh and finance voice.

Anonymous Fri Jul 15 13:23:51 2022 No.28243621

>>28243309
Maybe they just like collabing with Uki? He's inoffensive and gets along with everyone, just a generically good collab partner for large groups.

>>28243420
The last girl I talked to offline was easily 5+ years ago so I think you still have me beat. I avoid making eye contact with women in public these days.

>>	Anonymous Fri Jul 15 13:24:16 2022 No.28243643 >>28243588 if you think that's bad just wait until Pomu's Pomie plushy

>>	Anonymous Fri Jul 15 13:24:30 2022 No.28243657 mysta is wiggling his butt

>>	Anonymous Fri Jul 15 13:24:39 2022 No.28243665 File: 98 KB, 470x455, 1657789617488.jpg [View same] [iqdb] [saucenao] [google] Just made fudge brownies and they turned out really good

>>	Anonymous Fri Jul 15 13:24:55 2022 No.28243676 File: 481 KB, 645x686, 1650634234295.png [View same] [iqdb] [saucenao] [google] >>28243501 what the fuck i got 373... great art though, very nice

>>	Anonymous Fri Jul 15 13:24:58 2022 No.28243678 >>28243514 NO

>>	Anonymous Fri Jul 15 13:25:08 2022 No.28243688 >>28243422 the button is doing the best it can. keirei.

>>	Anonymous Fri Jul 15 13:25:08 2022 No.28243686 >>28243665 >malewife aloupeep

>>	Anonymous Fri Jul 15 13:25:21 2022 No.28243698 >>28243665 thanks for keeping us posted, care to share?

>>	Anonymous Fri Jul 15 13:25:21 2022 No.28243697 >>28243621 >Maybe they just like collabing with Uki they don't even interact that much on stream, uki is always in the background

Anonymous Fri Jul 15 13:25:21 2022 No.28243696

>>28243362
Wait how do you know Pomu wouldn't be the same way? Streaming is mostly her talking about her odd interests. What makes you think she'd happily listen to you talking about your weird fetishes while those other girls with weird fetishes wouldn't?

>>	Anonymous Fri Jul 15 13:25:42 2022 No.28243716 >>28243665 Share?

>>	Anonymous Fri Jul 15 13:25:53 2022 No.28243723 >>28243494 You know even Pomu paid Petra for her work on the MV despite offering to do it for free. Seems shitty to do of Reimu

>>	Anonymous Fri Jul 15 13:25:54 2022 No.28243724 >>28243686 I just used first pic i have save on my pic, i'm that 3 years old duvet insert pomudachi/dragoon

>>	Anonymous Fri Jul 15 13:25:56 2022 No.28243729 >>28243580 >>28243514 wtf

>>	Anonymous Fri Jul 15 13:26:21 2022 No.28243745 how good did leos do?

>>	Anonymous Fri Jul 15 13:26:30 2022 No.28243754 >>28243724 disgusting

Anonymous Fri Jul 15 13:26:39 2022 No.28243766
File: 1 KB, 125x86, 1657817026540s.jpg [View same] [iqdb] [saucenao] [google]

>>28243362
>No but if a person isn't at least slightly interested in archaeology or technology or outer space something must be wrong with them I think. Like all human progress has been inspired by the desire to seek out the unknown and learn about it, it's fascinating.

You clearly have something wrong with you because as a wise man once said "Different people like Different thing". I like history, for example.

>>	Anonymous Fri Jul 15 13:26:57 2022 No.28243780 >>28243434 You still didn't solved it ? Kek

>>	Anonymous Fri Jul 15 13:27:00 2022 No.28243785 >>28243309 nigga management doesn't care about anything. Petra collabs with JPfags all day that's on her. Selen already collabs with Pomu and Finana often.

>>	Anonymous Fri Jul 15 13:27:22 2022 No.28243803 >>28243621 token gay friend

>>	Anonymous Fri Jul 15 13:27:25 2022 No.28243806 >>28243723 OH NO NO WHAT DO I DO, SOMONE IS ATTEMPTING TO BAIT THROUGH SHITPOSTING AGAIN

>>	Anonymous Fri Jul 15 13:27:32 2022 No.28243814 >>28243745 he hates the fact that his players want to go to a good college instead of training for koushien

>>	Anonymous Fri Jul 15 13:27:35 2022 No.28243819 >>28243309 Selen will only accept a collab if it favors her inner numberfag. Pomu and Petra are only allowed to collab once every four months.

>>	Anonymous Fri Jul 15 13:28:36 2022 No.28243858 File: 1.02 MB, 4096x2896, FW-n_RiX0AI2hCV.jpg [View same] [iqdb] [saucenao] [google] >>28243329 >>28243149 Don't forget to consume fish 3 times per week for a healthy balanced diet.

>>	Anonymous Fri Jul 15 13:28:47 2022 No.28243867 Do you guys archive all your oshis vods? I'm in the process of doing it and holy shit... i need to buy a new external drive

>>	Anonymous Fri Jul 15 13:28:49 2022 No.28243868 >>28243806 It's shitty not to pay someone for the work they did especially if that person is a friend.

>>	Anonymous Fri Jul 15 13:29:38 2022 No.28243900 I'm too retarded to finish a full run of Integrated Strategy 2...

>>	Anonymous Fri Jul 15 13:29:51 2022 No.28243915 I'm looking at Mysta's ass.

>>	Anonymous Fri Jul 15 13:30:00 2022 No.28243923 >>28243867 save it in 360p

>>	Anonymous Fri Jul 15 13:30:05 2022 No.28243928 >>28243868 Honestly I kind of get it, if I did something like that for a friend I wouldn't want them to pay me

>>	Anonymous Fri Jul 15 13:30:23 2022 No.28243941 >>28243814 Fuckers don't need higher education when Oliver has a fucking G in contact, first time i see a G in anything

>>	Anonymous Fri Jul 15 13:30:40 2022 No.28243955 >>28243923 fuck no, whats the point then

>>	Anonymous Fri Jul 15 13:30:58 2022 No.28243971 >>28243858 I'm not into heavy metal.

>>	Anonymous Fri Jul 15 13:31:08 2022 No.28243980 >>28243955 the point is to archive your oshi's vod.

>>	Anonymous Fri Jul 15 13:31:10 2022 No.28243982 >>28243867 I'm not losing media I like anymore. A 4tb hard drive is $60 and AV1 can cut the size of VODs in half with no loss in quality.

>>	Anonymous Fri Jul 15 13:31:14 2022 No.28243983 >>28243806 >shitposting Just stating facts >>17996642 Dunno why Reimu couldn't pay Ike for his work.

>>	Anonymous Fri Jul 15 13:31:18 2022 No.28243987 >>28243867 I archive all of milord's asmrs at least. I might expand that to my favorite streams later on.

>>	Anonymous Fri Jul 15 13:31:22 2022 No.28243992 i was so certain randon would be wave 6 but now people are thinking he’s in holotempus… I just want a 30-something uncletuber with a bara model in nijien… well his clips are still up 2 days before the debut so maybe there’s still a chance

>>	Anonymous Fri Jul 15 13:31:51 2022 No.28244011 >>28243941 G is bad ... yes? I'm still trying to learn the rules!

>>	Anonymous Fri Jul 15 13:31:59 2022 No.28244019 >>28243716 >>28243698 Sorry my phone camera is shit, won't focus

>>	Anonymous Fri Jul 15 13:32:03 2022 No.28244025 >>28243819 >Pomu and Petra are only allowed to collab once every four months KEK

>>	Anonymous Fri Jul 15 13:32:18 2022 No.28244037 File: 127 KB, 1281x720, FW11aC5agAAuuDj.jpg [View same] [iqdb] [saucenao] [google]

Anonymous Fri Jul 15 13:32:26 2022 No.28244046
File: 209 KB, 866x944, 1638348874869.jpg [View same] [iqdb] [saucenao] [google]

>>28243696
The difference is Pomu doesn't exclusively talk about her interests. She picks out comments in chat to reply to and asks followup questions even if it's about stuff she has no idea about so she can learn new things. She gives off an air of being genuinely interested in learning about other people, which is rare.

Of course given what she's said about her experiences with idols we know this is just her way of bringing a smile to her viewers' faces and she's not actually very interested, but the fact she's so considerate of others to encourage them to talk about their passions already makes her worth all the love in the world. I just really admire her a lot for how she approaches streaming.

>>	Anonymous Fri Jul 15 13:32:27 2022 No.28244048 File: 2.81 MB, 3024x4000, 1640929937751.png [View same] [iqdb] [saucenao] [google] >>28243900 seriously bro level your scene, she's a cute autistic sloth who will carry you if you don't have scene then hahaha good luck newcutie

>>	Anonymous Fri Jul 15 13:32:37 2022 No.28244055 File: 463 KB, 910x1201, FXstHRuUYAAv4y-.jpg [View same] [iqdb] [saucenao] [google]

>>	Anonymous Fri Jul 15 13:32:48 2022 No.28244064 >>28243982 how long do those 4tb drives last? I fear the data will get corrupted with time.

>>	Anonymous Fri Jul 15 13:33:04 2022 No.28244075 >>28243941 >>28244011 G is bad. The highest stat is S

>>	Anonymous Fri Jul 15 13:33:10 2022 No.28244079 >>28243980 yes, but I also want to look at her in all her glory + whatever game/ food she's making

>>	Anonymous Fri Jul 15 13:33:13 2022 No.28244082 File: 165 KB, 884x224, It's Ogre.png [View same] [iqdb] [saucenao] [google] ......

>>	Anonymous Fri Jul 15 13:33:26 2022 No.28244090 >>28243415 she's gonna pay him personally during their trip iykwim...

>>	Anonymous Fri Jul 15 13:33:31 2022 No.28244094 >>28244055 So pretty...

>>	Anonymous Fri Jul 15 13:33:42 2022 No.28244106 >>28244082 MY SIDES

>>	Anonymous Fri Jul 15 13:33:45 2022 No.28244108 >>28243223 all the women are crazy here

>>	Anonymous Fri Jul 15 13:33:47 2022 No.28244111 >>28243723 >>28243868 reimu wanted to pay, ike didn't want it so she had to resort to sending it through supas. end of story.

>>	Anonymous Fri Jul 15 13:34:07 2022 No.28244123 >>28243867 no... i dont get too attached to media i like... ive had no problem wiping the same drive ive had for 5 years over and over for more space

>>	Anonymous Fri Jul 15 13:34:23 2022 No.28244131 >>28243858 I eat tuna everyday

>>	Anonymous Fri Jul 15 13:34:32 2022 No.28244134 >>28244055 what did she do to enna...

>>	Anonymous Fri Jul 15 13:34:47 2022 No.28244150 >>28243867 i'm fucked in terms of storage, so i've stopped archiving everything besides the most important things to me. i'd love to go full datahoarder with a server rack full of drives so i can archive everything but it's just too much storage

>>	Anonymous Fri Jul 15 13:34:50 2022 No.28244155 >>28244111 dumb reimu, she should have went through streamlabs

>>	Anonymous Fri Jul 15 13:35:01 2022 No.28244167 >>28244111 They’re going to keep samefagging about this for hours, ignore them. Same reimu schizo(s) everytime reimu is mentioned

>>	Anonymous Fri Jul 15 13:35:15 2022 No.28244176 >>28243858 Fish is about half my protein

>>	Anonymous Fri Jul 15 13:35:21 2022 No.28244180 >>28244064 that's why real data hoarders build a NAS with a ZFS RAID that has scrubbing enabled, that way the system will periodically scan over the data and ensure the checksums still match and restore it otherwise.

>>	Anonymous Fri Jul 15 13:35:29 2022 No.28244188 i just heard reimu’s cover and HOLY MOLYYYYY she sounds so cute! so proud of her

>>	Anonymous Fri Jul 15 13:35:52 2022 No.28244204 >>28244176 sonny please

Anonymous Fri Jul 15 13:35:58 2022 No.28244215

>>28244064
Years and years and years. The SMART checks it does on itself will let you know 95% of the time there's an issue before failing. Just don't buy the most dogshit cheap drive you can and you'll be fine. Reddit has buildapcsales as a link aggregator for sales, use that and look for storage. Unironically the only thing that site is good for

>>	Anonymous Fri Jul 15 13:36:01 2022 No.28244220 File: 78 KB, 341x360, 1656988435027.png [View same] [iqdb] [saucenao] [google] >>28244055 i'm no dragoon, but i kinda understand the appeal

>>	Anonymous Fri Jul 15 13:36:05 2022 No.28244227 >>28244155 She did.

>>	Anonymous Fri Jul 15 13:36:10 2022 No.28244234 >>28244111 KEK supas. Couldn't even send it through streamlabs even though she encouraged her own paypigs to move to streamlabs. What a hypocrite So it's more important to her to show off paying rather than actually compensate him properly

>>	Anonymous Fri Jul 15 13:36:19 2022 No.28244243 >>28244082 >From 3view to 0view Damn bro

>>	Anonymous Fri Jul 15 13:36:22 2022 No.28244249 >>28244082 Reimu...

Anonymous Fri Jul 15 13:36:27 2022 No.28244256

>>28243309
I don't think I've ever hated someone as much as I've come to hate Uki
Him being a creepy personalityless fag who sexually harassed the rest of the branch is bad enough
But he has also become the new Shu and has forced himself into girl only collabs he shouldn't be a part of whilst adding basically nothing to them besides killing teeter between the girls

>>	Anonymous Fri Jul 15 13:36:30 2022 No.28244260 File: 183 KB, 1245x2048, 3A9BB920-3914-4B07-9B03-34E59826BD96.jpg [View same] [iqdb] [saucenao] [google] Casual outfit Pomu

>>	Anonymous Fri Jul 15 13:36:35 2022 No.28244268 >>28244111 she's money laundering...

>>	Anonymous Fri Jul 15 13:37:10 2022 No.28244303 File: 620 KB, 1315x2028, 4DC36F54-83EF-4850-8E35-AD8CDCCBDB66.jpg [View same] [iqdb] [saucenao] [google] >>28244188 Cute latina, I’m going to need to watch this everyday together with my oshi’s cover now

>>	Anonymous Fri Jul 15 13:37:16 2022 No.28244310 >>28244111 >supas

>>	Anonymous Fri Jul 15 13:37:23 2022 No.28244316 >>28244260 Casual sex outfit Pomu

>>	Anonymous Fri Jul 15 13:37:54 2022 No.28244343 >>28243867 Would reuploading the VODs to Youtube privately be a good way to archive?

>>	Anonymous Fri Jul 15 13:38:20 2022 No.28244371 >>28244343 no

>>	Anonymous Fri Jul 15 13:38:20 2022 No.28244370 >>28244055 I don't really like that dress.

>>	Anonymous Fri Jul 15 13:38:32 2022 No.28244383 File: 184 KB, 1696x1690, 1642750924080.jpg [View same] [iqdb] [saucenao] [google] >>28243971 you should be https://www.youtube.com/watch?v=43sk-2zczTk

>>	Anonymous Fri Jul 15 13:38:41 2022 No.28244393 >>28244111 see, this is why you shouldn't reply to schizos...

>>	Anonymous Fri Jul 15 13:39:08 2022 No.28244419 >>28244234 She paid through streamlabs not supa

>>	Anonymous Fri Jul 15 13:39:19 2022 No.28244431 >>28244343 YouTube matches reuploads of existing videos even if you private them, also it'll reencode.

>>	Anonymous Fri Jul 15 13:39:26 2022 No.28244438 >>28243723 Pomu didn't paid Ike, he apparently does free mixing for everyone.

>>	Anonymous Fri Jul 15 13:39:51 2022 No.28244457 >>28244234 >hypocrite nina is a hypocrite. HYPOCRITE HATE! HATE!

>>	Anonymous Fri Jul 15 13:39:52 2022 No.28244458 .....

>>	Anonymous Fri Jul 15 13:39:53 2022 No.28244461 prepare for the flip cosplays tomorrow there's gonna be a local con

>>	Anonymous Fri Jul 15 13:40:06 2022 No.28244472 >>28244458 most sane post itt

>>	Anonymous Fri Jul 15 13:40:15 2022 No.28244484 >>28244461 i hope at least half of them are crossdressers

>>	Anonymous Fri Jul 15 13:40:22 2022 No.28244490 >>28244461 my penis is ready

Anonymous Fri Jul 15 13:40:40 2022 No.28244511

>>28244343
Anything other than offline storage puts you at the whims of other people. You can download select vods and compress them with AV1 if you need them smaller. I got Vox's Stanley Parable vod from 4.5 GB to 1.4 GB with no noticeable quality loss using AV1 and a GUI frontend for ffmpeg

>>	Anonymous Fri Jul 15 13:40:52 2022 No.28244518 It's really weird but I think I miss Nina.....

>>	Anonymous Fri Jul 15 13:40:53 2022 No.28244520 >>28244484 nah

>>	Anonymous Fri Jul 15 13:41:51 2022 No.28244576 >>28244461 cosplay carnival?

>>	Anonymous Fri Jul 15 13:41:52 2022 No.28244577 File: 266 KB, 948x225, 1638638094226.png [View same] [iqdb] [saucenao] [google] >>28244111 >>28244155 >>28244234 >>28244310 Reimu sent it via streamlabs, not superchats. https://youtu.be/cLGgUwZYC24?t=1231

>>	Anonymous Fri Jul 15 13:41:54 2022 No.28244580 I like to think nina is graduated whenever I don't see or hear anything about her. It makes my day so much better.

>>	Anonymous Fri Jul 15 13:42:21 2022 No.28244611 >>28244484 lmao you wouldn't like flip crossdressers

>>	Anonymous Fri Jul 15 13:42:58 2022 No.28244651 >>28244577 ah ok my bad, some anon said superchat so I assumed she sent it through youtube. I don't watch Ike so I wouldn't know how to verify this.

>>	Anonymous Fri Jul 15 13:42:58 2022 No.28244653 >>28244577 Do not reply to schizo

>>	Anonymous Fri Jul 15 13:43:17 2022 No.28244668 File: 2 KB, 559x43, 5893769973878493.png [View same] [iqdb] [saucenao] [google] >>28244234 >>28244310 my bad. it was a streamlab dono.

>>	Anonymous Fri Jul 15 13:43:23 2022 No.28244675 >>28244518 i didn't even know she was gone...

>>	Anonymous Fri Jul 15 13:43:30 2022 No.28244679 File: 2.89 MB, 600x338, 132674643876431.gif [View same] [iqdb] [saucenao] [google]

>>	Anonymous Fri Jul 15 13:43:53 2022 No.28244706 >>28244518 16 minutes!

>>	Anonymous Fri Jul 15 13:44:02 2022 No.28244719 >>28244653 they're not schizos, they're regular dumbfucks trying to start shit and deserve to be nipped in the bud

>>	Anonymous Fri Jul 15 13:44:24 2022 No.28244735 >>28244679 seffy cute

>>	Anonymous Fri Jul 15 13:44:27 2022 No.28244741 >>28244577 >Sent it through streamlabs instead directly into his Paypal or whatever What a bitch

>>	Anonymous Fri Jul 15 13:44:29 2022 No.28244746 >>28244576 Anime and Cosplay expo

>>	Anonymous Fri Jul 15 13:44:40 2022 No.28244754 File: 1.50 MB, 975x1435, 1657142669088.png [View same] [iqdb] [saucenao] [google] Good Morning Pomu!

>>	Anonymous Fri Jul 15 13:45:05 2022 No.28244776 >>28244577 She had to do it on stream huh?

>>	Anonymous Fri Jul 15 13:45:08 2022 No.28244778 File: 316 KB, 413x468, 1633880914640.png [View same] [iqdb] [saucenao] [google] If I can't marry Pomu then I'll kidnap a breedable aged female and forcefully inflict Pomufication upon her until she is Pomu.

>>	Anonymous Fri Jul 15 13:45:14 2022 No.28244785 >>28244741 I will strangle you

>>	Anonymous Fri Jul 15 13:45:25 2022 No.28244798 >>28244719 >they're regular dumbfucks trying to start shit so schizos?

>>	Anonymous Fri Jul 15 13:45:34 2022 No.28244809 >>28244776 He really really really didn't want it.

>>	Anonymous Fri Jul 15 13:45:45 2022 No.28244819 >>28244719 Yeah, schizos.

>>	Anonymous Fri Jul 15 13:46:03 2022 No.28244842 >>28244798 Regular schizos yes. We have one or two for each livers

>>	Anonymous Fri Jul 15 13:46:16 2022 No.28244851 >>28244785 Come try it, beesh

>>	Anonymous Fri Jul 15 13:46:20 2022 No.28244856 >>28244819 you don't know schizos. that word has lost it's meaning.

>>	Anonymous Fri Jul 15 13:46:31 2022 No.28244869 >>28244809 wow, so she's forcing him to accept money he doesn't want? That's fucking awful. I hope she dies! Anyway back to watching Gawr Gura oh she's not live

>>	Anonymous Fri Jul 15 13:46:53 2022 No.28244884 >>28244741 >reading comprehension dumbass

>>	Anonymous Fri Jul 15 13:47:14 2022 No.28244903 >>28244856 It’s schizo when anon call it schizo.

>>	Anonymous Fri Jul 15 13:47:24 2022 No.28244916 >>28244746 i wanna go... feels embarrassing to ask people to go out to a con though

>>	Anonymous Fri Jul 15 13:47:27 2022 No.28244918 File: 170 KB, 1200x675, 1652373163633.jpg [View same] [iqdb] [saucenao] [google] Hi I wish you all a good Friday! Do your best and don't push yourself too hard! And congratulations for making it through the week! here's a kiss for good luck chu~

>>	Anonymous Fri Jul 15 13:47:32 2022 No.28244928 >>28244851 yeah I bet you don't have much of a neck, tubby

>>	Anonymous Fri Jul 15 13:47:34 2022 No.28244933 >>28244903 ok schizo

>>	Anonymous Fri Jul 15 13:48:00 2022 No.28244951 BLACK BARS BLACK BARS BLACK BARS EVERYWHERE I SEE BLACK BARS

Anonymous Fri Jul 15 13:48:03 2022 No.28244954
File: 81 KB, 248x400, 1639978759064.jpg [View same] [iqdb] [saucenao] [google]

>>28242564
I'm not a fan of the song itself but it was a pretty cute cover, She has a very good "cute" voice even if it's not the kind of stuff I'd expect from her (I didn't follow her PL so apologies if she actually did this a lot back then)

>>	Anonymous Fri Jul 15 13:48:06 2022 No.28244958 >>28244916 theres probably a few flipanons that would go with you

>>	Anonymous Fri Jul 15 13:48:07 2022 No.28244959 Why is Atlus so shit with permissions I want a Niji to play Persona 5.

>>	Anonymous Fri Jul 15 13:48:15 2022 No.28244966 >>28244933 You too, schizo

>>	Anonymous Fri Jul 15 13:48:34 2022 No.28244990 File: 232 KB, 267x370, 1647136680910.png [View same] [iqdb] [saucenao] [google] >>28244918 thanks, you too peep

>>	Anonymous Fri Jul 15 13:48:37 2022 No.28244994 Is there any other Nijisanji livers call Petra as Peto?

>>	Anonymous Fri Jul 15 13:48:51 2022 No.28245006 anons help: lasagna rolls, burger, tacos, fried chicken, or bacon eggs and rice?

>>	Anonymous Fri Jul 15 13:48:54 2022 No.28245012 >>28244959 does persona 5 have trannies?

>>	Anonymous Fri Jul 15 13:49:07 2022 No.28245027 >>28244928 What can I say, more for you to grab on.

>>	Anonymous Fri Jul 15 13:49:16 2022 No.28245036 >>28244959 Someone need to kill the oldfucks at the top

>>	Anonymous Fri Jul 15 13:49:30 2022 No.28245050 >>28244954 Oh yes she did. She covered a shit ton of honeyworks songs.

>>	Anonymous Fri Jul 15 13:49:51 2022 No.28245068 >>28245006 burger and chimken

>>	Anonymous Fri Jul 15 13:49:57 2022 No.28245078 >>28245012 trannies raped a side character

Anonymous Fri Jul 15 13:50:02 2022 No.28245082

Reimu's cover was super adorable!
I'm not a huge fan of this kind of cutesy song, though, so I can't help but hope she sings something else in the future that allows her to show off her voice more.
I'll loop this fanmix meanwhile...
https://www.youtube.com/watch?v=QXsqPIoTeo4

If it took her 280 days to release her first cover, I still have hopes for my oshi :')

>>	Anonymous Fri Jul 15 13:50:11 2022 No.28245093 File: 287 KB, 1733x2048, 1657892986363.jpg [View same] [iqdb] [saucenao] [google] >>28244918 thanks aloupeep have a nice weekend!

>>	Anonymous Fri Jul 15 13:50:17 2022 No.28245099 >>28244959 Dragon's crown collab never ever.. 13 Sentinels stream never ever...

>>	Anonymous Fri Jul 15 13:50:19 2022 No.28245101 >>28244954 >She has a very good "cute" voice even if it's not the kind of stuff I'd expect from her You clearly don't follow her even now kek she loves to sing cutesy songs

>>	Anonymous Fri Jul 15 13:50:50 2022 No.28245129 Vtuber took over my anime addiction, i used to watch 5-6 hours of anime a day and now it's 10 hours of streams a day, same anyone ? Also this site took away my discord addiction

>>	Anonymous Fri Jul 15 13:51:00 2022 No.28245140 >>28245082 Shu will NEVER release a cover

>>	Anonymous Fri Jul 15 13:51:04 2022 No.28245146 >>28244037 Best fucking music duo.

>>	Anonymous Fri Jul 15 13:51:21 2022 No.28245158 >>28244959 Because fuck your leech Vtubers Profit loss is still profit loss

>>	Anonymous Fri Jul 15 13:51:36 2022 No.28245171 File: 439 KB, 1448x2048, IMG_20220712_113505.jpg [View same] [iqdb] [saucenao] [google] >>28244918 done doing wagie shit so i can actually chill for the whole day and play genshin and tarkov have a good day everyone

>>	Anonymous Fri Jul 15 13:51:39 2022 No.28245175 >>28245006 froid chomken

>>	Anonymous Fri Jul 15 13:51:41 2022 No.28245176 >>28245140 At this rate, Vox might do a cover before Shu.

>>	Anonymous Fri Jul 15 13:51:44 2022 No.28245180 >>28245146 petra...

>>	Anonymous Fri Jul 15 13:51:51 2022 No.28245187 >>28245006 Didn't you ask that like a week ago ? Tacos

>>	Anonymous Fri Jul 15 13:52:01 2022 No.28245194 >>28245129 Yea all the time I spent watching anime since 2021 has been dedicated to vtubers. Slowly trying to balance it out the past few months. Helpful because I watch less trashy anime now.

>>	Anonymous Fri Jul 15 13:52:22 2022 No.28245216 >>28245140 And this is why I'm jumping ship to StarsEN

>>	Anonymous Fri Jul 15 13:52:51 2022 No.28245241 >>28245187 I eat takeaway everyday, sometimes though I can't decide

>>	Anonymous Fri Jul 15 13:53:03 2022 No.28245252 File: 253 KB, 2048x1152, FXbHKBEXwAEn6I1.jpg [View same] [iqdb] [saucenao] [google] >>28245146 Really subjective and biased, but they are one of the best duos for me overall. I just love them.

>>	Anonymous Fri Jul 15 13:53:03 2022 No.28245251 >>28245216 Please do

>>	Anonymous Fri Jul 15 13:53:11 2022 No.28245260 >>28245194 Yeah i'm not even sure what i used to do before vtubers, i doubt i watched that many flesh streamers

>>	Anonymous Fri Jul 15 13:53:12 2022 No.28245263 >>28244055 Honestly Selen really should get smaller breasts Have massive tits just doesn't fit her

>>	Anonymous Fri Jul 15 13:53:19 2022 No.28245270 >>28245216 Does StarsEN have any cute blonde aussies? Just curious

>>	Anonymous Fri Jul 15 13:53:32 2022 No.28245277 >>28244958 i would rather be sad about not going to a con than meet up with someone /here/ desu

>>	Anonymous Fri Jul 15 13:53:51 2022 No.28245299 >>28245241 Anon, your wallet...

>>	Anonymous Fri Jul 15 13:53:58 2022 No.28245309 >>28245176 Bet. Mysta will release his before Shu's.

>>	Anonymous Fri Jul 15 13:54:00 2022 No.28245311 >>28245270 did they even announce the design?

>>	Anonymous Fri Jul 15 13:54:16 2022 No.28245327 >>28245299 8 figures a month

>>	Anonymous Fri Jul 15 13:54:40 2022 No.28245346 Mysta is going on a date with me!

>>	Anonymous Fri Jul 15 13:54:40 2022 No.28245345 Reimu first cover is about an idol wanting more gachikoi? bruh

Reply to thread

Name
E-mail
Subject
Comment
Action

Advanced search
Text to find
Subject [?]Search by post subject. Leave empty for any.
Username [?]Search for user name. Leave empty for any user name.
Tripcode [?]Search for tripcode. Leave empty for any.
Email [?]Search by email. Leave empty for any.
Filename [?]Search by image filename. Leave empty for any.
From Date [?]Enter what date to start searching from. Format is YYYY-MM-DD
To Date [?]Enter what date to start searching until. Format is YYYY-MM-DD
Image hash
Search in	All Posts OPs Only
Deleted posts	Show all posts Show only deleted posts Only show non-deleted posts
Internal posts	Show all posts Show only internal posts Show only archived posts
Order	New posts first Old posts first
Capcode	All Posts Only by Users Only by Mods Only by Admins Only by Developers
Results	Posts Threads
Action	[ Simple ]

/vt/ - Virtual Youtubers