[ 3 / biz / cgl / ck / diy / fa / ic / jp / lit / sci / vr / vt ] [ index / top / reports ] [ become a patron ] [ status ]
2023-11: Warosu is now out of extended maintenance.

/vr/ - Retro Games


View post   

File: 62 KB, 450x580, E5sz77SVcAAE-rn.jpg [View same] [iqdb] [saucenao] [google]
8614252 No.8614252 [Reply] [Original]

I haven't seen one of them in a long time.
Babes, girls, ladies, waifus...
Post Whatever you want
Extra points for some qt that we never seen before

>> No.8614276
File: 69 KB, 640x400, H_NAT_01.png [View same] [iqdb] [saucenao] [google]
8614276

>> No.8614278
File: 18 KB, 270x283, Nurse.jpg [View same] [iqdb] [saucenao] [google]
8614278

>> No.8614284
File: 1.67 MB, 1714x1677, 1515101_mogy64_roll-tron.png [View same] [iqdb] [saucenao] [google]
8614284

>> No.8614292
File: 423 KB, 1600x1200, Marelle.jpg [View same] [iqdb] [saucenao] [google]
8614292

Oh baby, dem abs

>> No.8614434
File: 149 KB, 992x642, mstrbaitress.jpg [View same] [iqdb] [saucenao] [google]
8614434

>> No.8614445
File: 172 KB, 1137x851, taut.jpg [View same] [iqdb] [saucenao] [google]
8614445

Japanese fighting games and their thigh goddesses.

>> No.8614453
File: 176 KB, 1139x858, bulk.jpg [View same] [iqdb] [saucenao] [google]
8614453

>> No.8614454
File: 82 KB, 365x410, 1644504093456.jpg [View same] [iqdb] [saucenao] [google]
8614454

>> No.8614456
File: 67 KB, 1078x746, iwant.jpg [View same] [iqdb] [saucenao] [google]
8614456

>> No.8614468

Potentially attractive game counselors, from recent Nintendo Power Storytime threads:
>>8592981
>>8581582
>>8581589
>>8581181

(One of those links may have been posted in jest.)

Also, various twelve-year-old boys' AOL waifu (with, I assume, a few twelve-year-old girls' husbandos): >>8592671

>> No.8614473
File: 2.71 MB, 2592x2549, 1608216308699.png [View same] [iqdb] [saucenao] [google]
8614473

A classic

>> No.8614474
File: 676 KB, 1117x816, 1644504144001.jpg [View same] [iqdb] [saucenao] [google]
8614474

>> No.8614489
File: 15 KB, 201x198, riza.gif [View same] [iqdb] [saucenao] [google]
8614489

>> No.8614495
File: 8 KB, 80x138, paperboy.jpg [View same] [iqdb] [saucenao] [google]
8614495

paper boy pizza girl

>> No.8614498
File: 50 KB, 299x322, 1644496703121.jpg [View same] [iqdb] [saucenao] [google]
8614498

>> No.8614501
File: 85 KB, 1000x563, cutthroat_island.jpg [View same] [iqdb] [saucenao] [google]
8614501

It turns out that Geena Davis is /vr/. https://www.youtube.com/watch?v=qhEBj8O339k

>> No.8614523
File: 107 KB, 1146x850, ass_force.jpg [View same] [iqdb] [saucenao] [google]
8614523

Justice League Task Force for SNES, despite not having been developed solely by Japanese people, has some pretty good Wonder Woman sprites. But the effect is marred by the weirdly masculine face she has a lot of the time (not shown here). Silly Americans and your unwillingness to pour master-level craft into children's cartoons and pornography!

>> No.8614538
File: 227 KB, 962x1700, Tyris Flare.jpg [View same] [iqdb] [saucenao] [google]
8614538

>> No.8614683

>>8614456
What game is this?

>> No.8614705

>>8614683
Martial Champions by Konami

>> No.8614706

>>8614683
MARTIALCHANPION

>> No.8614757
File: 12 KB, 164x300, Donald-Trump-04-GQ_11Jul17_getty_b~2.jpg [View same] [iqdb] [saucenao] [google]
8614757

>>8614495
based paper boy pizza girl poster

>> No.8614762
File: 6 KB, 80x96, 1562282337357.gif [View same] [iqdb] [saucenao] [google]
8614762

Big boobed hostage from the Punisher arcade game. There's some unfinished sprites of her bound and gagged as well.

>> No.8614798
File: 229 KB, 1280x720, maxresdefault(3).jpg [View same] [iqdb] [saucenao] [google]
8614798

>> No.8614816
File: 58 KB, 320x240, anna.jpg [View same] [iqdb] [saucenao] [google]
8614816

4ever in her 20s

>> No.8614820
File: 192 KB, 943x1000, BoFII_Katt.jpg [View same] [iqdb] [saucenao] [google]
8614820

no pants

>> No.8614846
File: 34 KB, 344x208, Brandish_3_BR3_05.png [View same] [iqdb] [saucenao] [google]
8614846

Still the best ass - 1996

>> No.8614858

>>8614846
Rusty: I kneel...

>> No.8614864
File: 278 KB, 393x562, file.png [View same] [iqdb] [saucenao] [google]
8614864

>cute girl
>dumb slapstick character in the back or worse in front

why

>> No.8614934

>>8614846
Japs are rarely ass men, but when they get it right, it's a beautiful sight.

>> No.8615006

>>8614252
Where is this from?

>> No.8615037
File: 333 KB, 921x1600, __christine_garland_super_real_mahjong_drawn_by_tanaka_ryou__0b1a8bd738c92980d1182a71f29a10c0.jpg [View same] [iqdb] [saucenao] [google]
8615037

>> No.8615046

>>8614798
Not retro

>> No.8615049

>>8614434
Damn, do i have to start playing fishing games?

>> No.8615061
File: 177 KB, 591x801, 1620980137124.jpg [View same] [iqdb] [saucenao] [google]
8615061

She's been my waifu since I was 10!

>> No.8615116

>>8615049

You have to go through every single one now! Just in case.

>> No.8615168
File: 2.50 MB, 2479x3511, 1638994377167.jpg [View same] [iqdb] [saucenao] [google]
8615168

>>8615049
Fishing games are a load of fun, so it's not as though you are going to suffer.

>> No.8615185
File: 284 KB, 650x581, 1596834025924.png [View same] [iqdb] [saucenao] [google]
8615185

>>8614434
>mstrbaitress

>> No.8615208
File: 533 KB, 847x854, 1641122615223.jpg [View same] [iqdb] [saucenao] [google]
8615208

>> No.8615307
File: 1.09 MB, 879x1299, 1644089953568.png [View same] [iqdb] [saucenao] [google]
8615307

>>8615168
More female hero.

>> No.8615316

>>8615208
Game?

>> No.8615325

>>8615316
It's Gachami from the Bishi Bashi series.

>> No.8615334

>>8615168
>>8615307
Literally Videl.

>> No.8615347

sexyPC98CGmania @ twitter, thank me later

>> No.8615351

>>8615208
She looks like she craves sex.

>> No.8615357

>>8615168
Ok, so tell me what game that cutie above is from.

>> No.8615360 [DELETED] 

>>8615351
kys

>> No.8615363
File: 57 KB, 1800x2865, 1635032065019.png [View same] [iqdb] [saucenao] [google]
8615363

>>8615347
PC98-style is just so boring. It looks pretty much like regular manga art with dithering.

>> No.8615372
File: 1010 KB, 627x995, 1643034652496.png [View same] [iqdb] [saucenao] [google]
8615372

>>8615325
Thanks I was looking something to emulate.
>>8615357
DQ3 female hero.

>> No.8615517
File: 289 KB, 827x1224, 1632450111500.jpg [View same] [iqdb] [saucenao] [google]
8615517

>>8614445
>and their thigh goddesses.
Ah yes, of course.

>> No.8615590

>>8615372
I meant this fine lady
>>8614434

>> No.8615597

>>8615517
Based VGbro...

>> No.8615598
File: 63 KB, 382x512, E02ciDjWYAE0pO2.jpg [View same] [iqdb] [saucenao] [google]
8615598

OP here
>>8615006
Arabian Fight
>>8614864
>With better res
Save it: thanks anon
>>8615347
I follow another account named @pc98-bot

>> No.8615616
File: 171 KB, 950x794, doom89.jpg [View same] [iqdb] [saucenao] [google]
8615616

>>8615590

Do you really not want to just play through every fishing game and find out? You heard it from anon - they are a load of fun. (I have not ever played one myself but I assume anon is 100% correct in this matter as in all matters)

Anyway let's make this more American for a change. Or British as the case may be, since Rare developed this game.

>> No.8615620
File: 11 KB, 222x438, rrend.png [View same] [iqdb] [saucenao] [google]
8615620

>>8615616

Well that didn't go well. Okay back to Japan, they drew it better on what is apparently the Japanese version of Bugs Bunny Crazy Castle.

>> No.8615624
File: 388 KB, 2000x3273, not_bad.jpg [View same] [iqdb] [saucenao] [google]
8615624

>>8615620

In case you weren't TOTALLY clear on what character is being referred to here, I include a larger piece for academic reference

>> No.8615627

>>8615620
Bless Japan

>> No.8615630

>>8615598
Nice thank you anon

>> No.8615645
File: 528 KB, 1078x1200, 89747533_p0_master1200.jpg [View same] [iqdb] [saucenao] [google]
8615645

>>8614284

>> No.8615646
File: 146 KB, 1141x825, cool_world.jpg [View same] [iqdb] [saucenao] [google]
8615646

Now back to America, or Israel if you prefer since Ralph Bakshi was apparently born there, or England again since that is where this game was developed.

>> No.8615656
File: 159 KB, 1140x850, cw1.jpg [View same] [iqdb] [saucenao] [google]
8615656

>>8615646

Well, maybe she looks better in the game??

>> No.8615659
File: 101 KB, 1141x848, cw3.jpg [View same] [iqdb] [saucenao] [google]
8615659

>>8615656

Okay maybe not. Still, she does eventually gain some contours, when she kisses you on a rooftop and thereby bamboozles you into allowing her to become real, or something. (This sequence is crudely animated but I did not feel like making a GIF out of it.)

>> No.8615663

>>8614284
>that fucking plate
good gawd

>> No.8615671
File: 159 KB, 1139x855, cw4.jpg [View same] [iqdb] [saucenao] [google]
8615671

>>8615659

Eventually you catch up with her and stuff her back into the toon world I guess. A British person takes the opportunity to draw her sweet tits and ass again.

>> No.8615674
File: 69 KB, 600x930, a4b2bbd16a77dd20ebb4d9d3760f88f4.jpg [View same] [iqdb] [saucenao] [google]
8615674

>> No.8615675
File: 108 KB, 1359x857, cwa.jpg [View same] [iqdb] [saucenao] [google]
8615675

>>8615671

MEANWHILE, possibly there was a different time at which Kim Basinger first became /vr/?? Because this title also appeared on the Amiga for some reason. Now HERE is the one children possibly probably masturbated to (see the intro video): https://www.youtube.com/watch?v=-g9rNc2TkIQ

>> No.8615693
File: 89 KB, 800x1060, 1378184740266.jpg [View same] [iqdb] [saucenao] [google]
8615693

1 E-beer please

>> No.8615706
File: 35 KB, 300x281, power.png [View same] [iqdb] [saucenao] [google]
8615706

>>8615693

Hey come on this thread isn't for minors. Also you should be drinking hetap until you're old enough

>> No.8615742

>>8615663
It's a buckle on the leotard she wears under the dress.

>> No.8615763

>>8614276
FPBP

>> No.8615779
File: 507 KB, 1024x896, she_often_teases.png [View same] [iqdb] [saucenao] [google]
8615779

>> No.8615892
File: 29 KB, 384x224, 670632-dungeons-dragons-shadow-over-mystara-arcade-screenshot-shopping.png [View same] [iqdb] [saucenao] [google]
8615892

>> No.8615962
File: 6 KB, 256x232, Cadash_(TG16)_032.png [View same] [iqdb] [saucenao] [google]
8615962

I blame 16-bit pixel nudity for giving me a thing for mermaids.

>> No.8615974
File: 16 KB, 201x635, 19926.png [View same] [iqdb] [saucenao] [google]
8615974

>>8615962
Harpies too.

>> No.8616053

>>8615974

Shining Force got me interested in centaurs

>> No.8616061
File: 575 KB, 512x384, 1478486032820.gif [View same] [iqdb] [saucenao] [google]
8616061

>>8615598
That's the same image, I just cleaned it up a bit

>> No.8616075

>>8616053
horse puss ain't that great

>> No.8616085
File: 107 KB, 502x800, SF_Mae.jpg [View same] [iqdb] [saucenao] [google]
8616085

>>8616053
Same. I had a crush on Mae as a kid, and I'm not ashamed to admit it.

>> No.8616094
File: 307 KB, 500x480, tumblr_inline_ocvwqvVJNk1r2gkqp_500.gif [View same] [iqdb] [saucenao] [google]
8616094

>>8615962
>>8615974
Play Sugoro Quest then: you won't regret

>> No.8616138
File: 153 KB, 1345x864, 0022022184305.jpg [View same] [iqdb] [saucenao] [google]
8616138

Camilla

>> No.8616140
File: 48 KB, 316x474, shinju.jpg [View same] [iqdb] [saucenao] [google]
8616140

>> No.8616158
File: 269 KB, 511x600, 3000.png [View same] [iqdb] [saucenao] [google]
8616158

>>8616075

Honestly, I could say the same thing about your pussy

>> No.8616207
File: 27 KB, 478x448, Sugoros-Quest-085.jpg [View same] [iqdb] [saucenao] [google]
8616207

>>8616094
I'm surprised I've never heard of that before, since it looks like my kind of thing. Thanks for the recommendation.

>> No.8616236

>>8614934
>Japs are rarely ass men
Nice parroting, imbecile.

>> No.8616243

>>8616207
This is pretty much the only Technos game on the Famicom that didn't involve Kunio or the Lee boys (they had a cameo in Super Spike V'Ball).

>> No.8616345
File: 16 KB, 300x350, fucking degenerate.jpg [View same] [iqdb] [saucenao] [google]
8616345

>>8616085
>no cover in the back

>> No.8616348

>>8616094
>Sugoro Quest
Boring as fuck board game trying to look like an RPG

>> No.8616364
File: 165 KB, 1920x907, Art Girl MML1.png [View same] [iqdb] [saucenao] [google]
8616364

Megaman Legends 1 and 2 had some QTs.

>> No.8616367

>>8614434
sauce?

>> No.8616407

>>8614276
I will never understand the appeal for this garbage art

Name 1 (one) PC98 game with boobs that are big that also look halfway decent. I'll wait.

>> No.8616418

>>8616407
Policenauts

>> No.8616441

>>8616345
Horse pussy is free use

>> No.8616461
File: 171 KB, 571x800, __matilda_shining_and_1_more_drawn_by_agahari__3573a803513146327f9a1ed4c63a34dc.jpg [View same] [iqdb] [saucenao] [google]
8616461

>>8616053
>>8616085
Make way for the based centaur!

>> No.8616469
File: 543 KB, 336x224, ES CR.gif [View same] [iqdb] [saucenao] [google]
8616469

How do I get a woman to do this to me?

>> No.8616486

>>8616469
first you need to isekai yourself.

>> No.8616534

>>8616461
I don't understand the physiology here. If her organs are all in her human torso then the horse part is going to be mostly empty.

>> No.8616564
File: 197 KB, 1969x2581, 1980s_laddle.jpg [View same] [iqdb] [saucenao] [google]
8616564

Oh! I must have taken a wrong turn. I could have sworn this was actually a thread for /vr/laddles.

>> No.8616582
File: 137 KB, 640x400, Dlm5VSyXgAAuss_.jpg [View same] [iqdb] [saucenao] [google]
8616582

>>8616407
This?
I think it's more the artstyle in each game than the PC-98 itself

>> No.8616632

>>8616407
Appealing to you sounds like a waste of time.

>> No.8616640
File: 166 KB, 560x800, 29037955_p5.jpg [View same] [iqdb] [saucenao] [google]
8616640

>> No.8616642
File: 702 KB, 2480x3508, 84952697_p0.jpg [View same] [iqdb] [saucenao] [google]
8616642

>> No.8616663
File: 2.44 MB, 4320x5400, 1624062145573.jpg [View same] [iqdb] [saucenao] [google]
8616663

>> No.8616667
File: 475 KB, 1530x2260, 1624465502537.jpg [View same] [iqdb] [saucenao] [google]
8616667

>> No.8616670
File: 1.09 MB, 1920x1080, 17b578f2-f020-4a58-b93b-d5370ac9c4c3.png [View same] [iqdb] [saucenao] [google]
8616670

>> No.8616675
File: 285 KB, 618x700, 1633548747931.jpg [View same] [iqdb] [saucenao] [google]
8616675

>> No.8616681

>>8616469
meds

>> No.8616757
File: 838 KB, 1140x1400, 75603724_p0.jpg [View same] [iqdb] [saucenao] [google]
8616757

>>8614473
I feel as if Valkyrie was the inspiration behind Sophitia for the Soul series. Also bonus points to Sophi for having Ki as her secret costume later in the series.

>> No.8616776

>>8616469
That's not a woman, anon. That's an insect.

>> No.8616781

>>8616776
A damn sexy insect.

>> No.8616794

>>8616236
>posts no evidence on the contrary
Weak.

>> No.8616858
File: 1.90 MB, 1185x1185, Felicia chart.png [View same] [iqdb] [saucenao] [google]
8616858

>>8614252
I love Felicia with all my heart.

>>8614820
Fur is all ya need.

>> No.8616861

>>8616781
You know her eyes are the big bulbs on her head, right? The face is just decorative and meant to lure in unsuspecting prey. That's why her idle animation has her "face" staring at the floor. She's actually looking directly at her opponent.

>> No.8616935
File: 131 KB, 1200x1300, 707f3d34d37e46cfbb8407587a22e583.jpg [View same] [iqdb] [saucenao] [google]
8616935

>>8614284
I'm glad someone posted them so quick

>> No.8616938
File: 449 KB, 679x972, oneladyfromtheschool.png [View same] [iqdb] [saucenao] [google]
8616938

>>8616364
Legends 2 had some fucking tits for like no reason

>> No.8617030

>>8615046
Homebrew games are allowed

>> No.8617064 [DELETED] 

>>8617030
No

>> No.8617068
File: 87 KB, 488x573, rust11.png [View same] [iqdb] [saucenao] [google]
8617068

rusty

>> No.8617073

>>8617068
I hope this mod is only the first in a long line of butt fixes.

>> No.8617130
File: 61 KB, 642x402, rusty-13.png [View same] [iqdb] [saucenao] [google]
8617130

>>8617068
in the original videogame, the artists were so lazy that they did not finished rusty butt in the ending. Good thing someone finished it.

>> No.8617139

>>8616407

You're saying the boobs are the problem? They look pretty nice to me. The gorilla shoulders and arms and the not-even-trying-to-look-human face are my problems with it.

>> No.8617241
File: 269 KB, 850x1247, 151_vgcvc014.jpg [View same] [iqdb] [saucenao] [google]
8617241

>>8615517
Never ever a team V.G. in KOFXV
Yuka, Elirin, Jun or Yuka, Tamao, Satomi
SNK, look at the dimes, yens, shekels, eurodollars!

>> No.8617409
File: 424 KB, 726x474, FCD90180-EA39-4F34-B276-FDA12C4A2E41.png [View same] [iqdb] [saucenao] [google]
8617409

>>8614705
This game has some QTs

>> No.8617415

>>8616858
Looks like one of those "Artist and her art" challenge

>> No.8617426

>>8616794
Go to any booru or exhentai and check the art, midwit.

>> No.8617436
File: 159 KB, 660x985, sh-nurse.jpg [View same] [iqdb] [saucenao] [google]
8617436

>>8614278
>not posting bigger image

>> No.8617475
File: 244 KB, 854x724, f15.png [View same] [iqdb] [saucenao] [google]
8617475

>>8616075

>> No.8617490
File: 122 KB, 1236x781, suddenly.jpg [View same] [iqdb] [saucenao] [google]
8617490

>> No.8617517
File: 154 KB, 567x492, C136B5F1-BF91-45E3-8BE1-5AF22130DE82.jpg [View same] [iqdb] [saucenao] [google]
8617517

>>8614495

>> No.8617527
File: 102 KB, 1133x804, cooper.jpg [View same] [iqdb] [saucenao] [google]
8617527

>> No.8617603
File: 121 KB, 735x1103, 73903526_p0.jpg [View same] [iqdb] [saucenao] [google]
8617603

>>8617409
Rachael's character designer, Yoshiki Akasaka, has accounts on Twitter and Pixiv.
https://www.pixiv.net/en/users/36404
https://twitter.com/logan0241

>> No.8617914

>>8614276
Don't.

>> No.8618147
File: 401 KB, 887x1200, 58976326-0429-4F80-A1AF-0C9A39D22444.jpg [View same] [iqdb] [saucenao] [google]
8618147

maybe someday

>> No.8618247
File: 1.37 MB, 1366x768, valkiryepowerbeatiues.png [View same] [iqdb] [saucenao] [google]
8618247

>>8614252
valkirye the power beauties has some of them

>> No.8618620

>>8618147
>April

>> No.8618627

>>8617914
Based

>> No.8618728
File: 88 KB, 640x480, 1632564503119.jpg [View same] [iqdb] [saucenao] [google]
8618728

>>8617241
Not gonna happen because barely anyone in Japan remembers V.G., not to mention barely anyone knows the game in the West. We can only dream.

Oh well, let's post more of them V.G. Senshi.

>> No.8618769
File: 162 KB, 850x1261, Kaori.jpg [View same] [iqdb] [saucenao] [google]
8618769

>>8617241
>>8618728
Based VGbros...

>> No.8618885
File: 625 KB, 1041x973, 40473658_p0.png [View same] [iqdb] [saucenao] [google]
8618885

>> No.8618887
File: 53 KB, 745x865, 39607884_p8.png [View same] [iqdb] [saucenao] [google]
8618887

>> No.8618910

No pic on this computer but BlackRose

>> No.8619165
File: 1.21 MB, 1280x1097, file.png [View same] [iqdb] [saucenao] [google]
8619165

Justin's mom is a babe

>> No.8619176

>>8618887
Based highest defence pso slut.

>> No.8619243

>>8618769
The best girl of VG

>> No.8619256
File: 250 KB, 707x1000, sample-c4ecdaf0dccc252e26396445e1a257d5.jpg [View same] [iqdb] [saucenao] [google]
8619256

1st girl always wins

>> No.8619267

>>8619243
Of course!

>> No.8619294

>>8619256
>1st girl
the first girl was "Lady" no?

>> No.8619332
File: 1.42 MB, 219x372, tumblr_oyfrwgpW081sqrj9ko2_250.gif [View same] [iqdb] [saucenao] [google]
8619332

>>8619294
Depending on who you ask?

America always called her Pauline and she is all one person.


Japan had 2 different characters, Lady (Donkey Kong and DK mangas) and Pauline (Donkey Kong GBC and beyond). Both Pauline and Lady were together in the newer GBC DK mangas.

But in the modern era of Nintendo Lady is no more and Pauline is retcon as always been the main DK gal from Day 1 and even her dance in New Donk City is a homage to Lady's idle animation. Today worldwide Pauline = Lady

>> No.8619347
File: 399 KB, 854x512, pauline_s_hairstyles_by_albertojz356-d72v8ws.png [View same] [iqdb] [saucenao] [google]
8619347

>>8619332
Artistic evolution over 35 years

Much how Peach / Princess Toadstool went from dirty blond, to red head , to blond

>> No.8619820

>>8616367
Mark Davis' The Fishing Master on SNES. I had to dig through Moby games to find it, so I hope you appreciate the effort.

>> No.8620238
File: 223 KB, 300x464, 060E463E-6549-4039-8FD9-822313D0176A.png [View same] [iqdb] [saucenao] [google]
8620238

>>8618769
I had no idea V.G. was so popular around here

>> No.8620308
File: 192 KB, 850x634, 207_vgcvc070.jpg [View same] [iqdb] [saucenao] [google]
8620308

>>8620238
It's /vr/, it's 90s cel animation OVA kino, it's different flavors of tits for different men of different taste, it's a fighting game. It's awesome

>> No.8620336
File: 34 KB, 263x384, yuka.jpg [View same] [iqdb] [saucenao] [google]
8620336

>>8620308
>it's 90s cel animation OVA kino
Could be better and longer tho. I absolutely love the animation and art style, but the rest is just... meh.

>> No.8620339
File: 283 KB, 1280x932, 227_vgcvcposter.jpg [View same] [iqdb] [saucenao] [google]
8620339

>> No.8620442
File: 127 KB, 336x224, qbee.gif [View same] [iqdb] [saucenao] [google]
8620442

>>8616469

>> No.8620456

>>8618147
It baffles me that no one has made a mod of Valkyrie Wilde for all Tomb Raider games and other ps1 looking action games, like a model as close as possible to these images.

>> No.8620457
File: 1.02 MB, 212x212, mike sweaty.gif [View same] [iqdb] [saucenao] [google]
8620457

>>8617517

>> No.8620459

>>8616861
it's working

>> No.8620462

>>8616938
>>8616364
Why can't we have more games that look exactly like this? it should be piss easy for indy devs to make this nowadays, no? there's not a lot of detail and it's very blocky.

>> No.8620467

>>8617073
underrated

>> No.8620470

>>8619332
>hat wobbles
>hair moves
>dress moves
>static tits
EST

>> No.8620484

>>8620442
hot

>> No.8620492

>>8615675
I whould totally fap to it, even today if I dont have any other thing to fap of looks like a good option.

>> No.8620496 [DELETED] 
File: 148 KB, 704x480, HardWork.jpg [View same] [iqdb] [saucenao] [google]
8620496

A Sabrina would be fine too

>> No.8620505

>>8620442

Well surely we should have one where she's doing it to Felicia or whatever? I haven't played that game but I assume this move works on other characters?

>> No.8620517

>>8620496
She's /co/ and not /vr/.

>> No.8620538

>>8620517
I mean she's prominently featured in a series of Amiga executables, but I guess it's a bit lacking in the interactive department

>> No.8620549

>>8620538
>Amiga executables
They weren't. They were just standard IFF animations. Essentially video files.

>> No.8620553
File: 97 KB, 540x679, tumblr_34d34ef856e971faf921b2d93d14f952_aad85d96_540.jpg [View same] [iqdb] [saucenao] [google]
8620553

>> No.8620560
File: 1.28 MB, 757x1629, Alicia.png [View same] [iqdb] [saucenao] [google]
8620560

>>8620549
Huh, didn't know that. Guess I'll go with Alicia Pris instead then

>> No.8620570

>>8620560
Why the fuck would they be executables? That means you basically have them be attached to the video player.

>> No.8620576
File: 1.53 MB, 1536x706, cool world.webm [View same] [iqdb] [saucenao] [google]
8620576

>>8615675

>> No.8620578
File: 163 KB, 1280x1657, 20210616170159.jpg [View same] [iqdb] [saucenao] [google]
8620578

>>8614252
Thanks to random youtube let's play video

>> No.8620580
File: 210 KB, 1280x1656, 20210616170151.jpg [View same] [iqdb] [saucenao] [google]
8620580

>>8620578

>> No.8620595
File: 178 KB, 2045x3435, 1623019006770.jpg [View same] [iqdb] [saucenao] [google]
8620595

>> No.8620604

>>8620570
Some of Eric's earlier animations such as "At The Movies" were distinctly using just few animated elements at a time, always took for granted this was because of it not being full frame-by-frame animation, but I guess it's more of a testament to just how much Eric improved over the years.

>> No.8620630
File: 47 KB, 285x406, ps-rouge_butt.jpg [View same] [iqdb] [saucenao] [google]
8620630

>> No.8620638
File: 228 KB, 704x1072, naked lizzer.jpg [View same] [iqdb] [saucenao] [google]
8620638

>> No.8620641 [DELETED] 

>>8616140
not retro

>> No.8620645

>>8620630
Hey, it's the tits-and-ass pose that obese tumblrites always told me was impossible IRL.

>> No.8620685
File: 70 KB, 640x480, soko-hime-baldrfist.jpg [View same] [iqdb] [saucenao] [google]
8620685

>>8620641

A Windows game from 2003 qualifies as far as I know. Anyway, post ladies.

>> No.8620776
File: 68 KB, 550x688, 1368946179883.jpg [View same] [iqdb] [saucenao] [google]
8620776

>> No.8620870

>>8615892
>tfw no delicious drow gf

>> No.8620878

>>8620442
>ywn be stinger creampied by Q-bee
Why live?

>> No.8620959
File: 67 KB, 600x789, 14578397.jpg [View same] [iqdb] [saucenao] [google]
8620959

>> No.8621108
File: 484 KB, 826x1000, file.png [View same] [iqdb] [saucenao] [google]
8621108

>> No.8621297

>>8615517
Elirin won...

>> No.8621372
File: 2.34 MB, 480x480, q.gif [View same] [iqdb] [saucenao] [google]
8621372

According to my five seconds' worth of serious research, bees have FIVE eyes. So maybe those ones on the human face are functional.

>> No.8621404

>>8621372
I am deathly afraid of bees in real life why do I want to fuck one now

>> No.8621467

>>8621404
Pfftt, I've had a whole nest of wasps here once and they barely did anything, if there is anything you should be scared of it's blacks

>> No.8621490

>>8621372
where's the fifth eye?

>> No.8621724
File: 3.55 MB, 938x780, 1572222597908.gif [View same] [iqdb] [saucenao] [google]
8621724

She's fun to play in vsav

>> No.8621742

>>8620580
>>8620578
bless the man who scanned this.

>> No.8621792 [DELETED] 
File: 71 KB, 472x471, 5lodis.png [View same] [iqdb] [saucenao] [google]
8621792

>>8615675
Children?

>> No.8621906

Red Alarm for the Virtual Boy had a secret girl! >>8613262

And what a beaut she is

>> No.8621930

>>8615693
Holy yuck. Worst roll I've seen on here yet.

>> No.8621937
File: 775 KB, 960x1280, 1378277967151.jpg [View same] [iqdb] [saucenao] [google]
8621937

>>8621930
Why are you gae

>> No.8622258

>>8621372
Look up how bees see. Apparently they can see wavelengths into the ultraviolet spectrum which help them spot flowers and the simulations of what that looks like are wild.

>> No.8622339
File: 536 KB, 1638x2048, 1639286877898.jpg [View same] [iqdb] [saucenao] [google]
8622339

>> No.8622340
File: 88 KB, 900x601, killer-instinctorchid.jpg [View same] [iqdb] [saucenao] [google]
8622340

>> No.8622342
File: 1.67 MB, 1339x2467, 50412480_p1.png [View same] [iqdb] [saucenao] [google]
8622342

>> No.8622345

>>8620553
source?

>> No.8622346
File: 616 KB, 1470x1000, 50412480_p2.png [View same] [iqdb] [saucenao] [google]
8622346

>> No.8622348
File: 1.07 MB, 1241x1706, 1632590831249.png [View same] [iqdb] [saucenao] [google]
8622348

>> No.8622349
File: 3.21 MB, 1024x1204, alisia_dragoon_by_danmakuman_delzzo8-fullview.png [View same] [iqdb] [saucenao] [google]
8622349

>> No.8622414
File: 145 KB, 499x410, file.png [View same] [iqdb] [saucenao] [google]
8622414

YAMERO TAKESHI

>> No.8622457 [DELETED] 

>>8622414
>>8621792
>>8620457
>>8616564
>>8616345
>>8615185
Thanks for the image limit -1

>> No.8622567

>>8622345
Comic from Marukatsu Mega Drive, late 1993 - Part 3
(July number of Marukatsu Mega Drive not scanned)

https://segaretro.org/index.php?title=File:MarukatuMD_JP_07.pdf&page=83

>> No.8622692

>>8615693
>>8621937
UOOOOHH~

>> No.8622953

>>8621467
Is Qbee black? I’ve always kinda thought she looks it.

>> No.8622990
File: 640 KB, 995x1440, 20210920_001437.jpg [View same] [iqdb] [saucenao] [google]
8622990

>>8622692

>> No.8622995
File: 683 KB, 1200x636, DADC9C37-F477-4A89-9DE4-538F2988BCA5.jpg [View same] [iqdb] [saucenao] [google]
8622995

>> No.8623407

>>8614252
The problem a /vr/ girls thread is that the list of female characters that are considered /vr/ is static and limited to female characters created between Ms. Pac-Man and fucking Midna.

SO YOU ALWAYS SEE THE SAME SHIT POSTED

>> No.8623435

>>8623407
>hundreds to thousands of games with female characters
>modern art of retro characters counts
There’s plenty of material available

>> No.8623656

>>8623407
Maybe stop browsing this site so much, lol

>> No.8623667
File: 87 KB, 480x320, 1484164879048.png [View same] [iqdb] [saucenao] [google]
8623667

Every beat-'em-up needs to start with an image of the hero's kidnapped girlfriend in bondage to get you motivated to play it.

>> No.8623669

>>8623407
Then be the change you want to see, help /vr/ dig out some underappreciated female characters.

>> No.8623714
File: 269 KB, 1600x1200, s-l1600 (60).jpg [View same] [iqdb] [saucenao] [google]
8623714

>>8623407
There is so many niche waifus in the world of gaming. Stop being a casual normie anon.

(Source Baseball Dating sim for Saturn Doki Doki Pretty League)

>> No.8623725

>>8623714
More Doki Doki Pretty League, pretty much Tokimeki meets Softball

https://www.youtube.com/watch?v=-e2hFd2TIl4

>> No.8623787

>>8623669

Seriously, there are lots of fishing games that haven't been scoured through

>> No.8623923

>>8622567
thanks a lot

>> No.8623929
File: 220 KB, 1024x725, mugen_senshi_valis_iii_by_danmakuman_degcyw1-fullview.jpg [View same] [iqdb] [saucenao] [google]
8623929

>>8622342
>>8622346
>>8622349
Patrician taste. Also that Danmakuman guy makes art that looks almost like from the era. A shame he's a brony and possibly a furry.

>> No.8623948

>>8614278
Reminds me of that female pyramid head doujin. Time to fap

>> No.8623953

>>8623929
Shame that IP ended up in the hands of some adult doujin makers

>> No.8624068

>>8623407
Doesn't matter since the best waifus are all /vr/ and will continue to stand the test of time. Some of the most popular characters are Tifa, Ankha, and you said it yourself, Midna. Absolute baboon mentality.

>> No.8624080

>>8623929
Danmakuman is based and one of us, I wish more porn artists recorded themselves 1ccing Thunder Force IV. Now I wanna see minus8 do a no hit run of Minus Infinity or for Zone to 1cc Super Fantasy Zone.

>> No.8624096 [DELETED] 

>>8624080
He can go fuck himself and I hope that degen kills himself, that fucker

>> No.8624124

>>8624080
>fellating e-celebs
sounds like cringe bro

>> No.8624287 [DELETED] 

>>8623929
>danmakuman
>bronyfag
Double the cringe.

>> No.8624490 [DELETED] 

>>8624124
this is how you make riends

>> No.8624491 [DELETED] 

>>8624287
He's got a shitton of MLP related art on his dA profile.

>> No.8624513 [DELETED] 

>>8623929
>shmup guy is an autistic furry pederast
Not at all surprising, really.

>> No.8624520 [DELETED] 

>>8624490
By sucking off strangers in dark alleys?!

>> No.8624545 [DELETED] 

>>8624513
>>8624287
It all makes sense now

>> No.8624616

>>8614252
Ramaya needs moar art

>> No.8624793

>>8622953
Are you fucking blind?

>> No.8624806
File: 290 KB, 850x1105, MV5BNmQzNmFjZTMtYzMzMi00ZGVmLWFmNzctZDVkOTg3YTE4ZTZkXkEyXkFqcGdeQXVyNzg5OTk2OA@@._V1_.jpg [View same] [iqdb] [saucenao] [google]
8624806

>> No.8624908
File: 24 KB, 236x330, e5246dd3219437943042445ad8bf6269--donkey-kong-mario-bros.jpg [View same] [iqdb] [saucenao] [google]
8624908

You never forget the first gal you saved.

>> No.8624931
File: 2.29 MB, 1169x1800, 1A7B73BD-6B7F-44A7-B4C9-E50B87B86C9F.jpg [View same] [iqdb] [saucenao] [google]
8624931

>>8624793
I dunno man sometimes

>> No.8625064

>>8624931
Real men play sega saturn, obviously.

>> No.8625082

>>8624931
Not a fan of this artstyle and use of colors for SF and Darkstalkers.

>> No.8625083
File: 1.06 MB, 104x110, dieanna.gif [View same] [iqdb] [saucenao] [google]
8625083

>> No.8625086
File: 21 KB, 147x292, Marian_-_05.png [View same] [iqdb] [saucenao] [google]
8625086

>>8624908
Probably explains why I'm still obsessed with Marian and Jessica.

>> No.8625571
File: 28 KB, 640x400, EKVm9DXX0AUCek-.png [View same] [iqdb] [saucenao] [google]
8625571

>> No.8625594
File: 292 KB, 2048x1536, 1538952422909.jpg [View same] [iqdb] [saucenao] [google]
8625594

>> No.8626117

>>8625083
https://youtu.be/HwJTew1Gk2c

>> No.8626438
File: 66 KB, 600x894, Servbot.jpg [View same] [iqdb] [saucenao] [google]
8626438

>>8620462
i'm not too sure. i'm sure one will come out one day but it's probably just harder to mask environments. Everything was lower quality back then so if you wanted to do this you'd have to go all out. I'd love to learn how to but I simply don't think I have the time to

>> No.8626551

>>8626117
Cute!

>> No.8626575 [DELETED] 

>>8617064
t. newfag

>> No.8627120
File: 333 KB, 320x157, sheena-smile.gif [View same] [iqdb] [saucenao] [google]
8627120

>> No.8627126
File: 928 KB, 293x165, sheena-ninjamagic.gif [View same] [iqdb] [saucenao] [google]
8627126

>> No.8627129
File: 49 KB, 400x450, raine_reading.gif [View same] [iqdb] [saucenao] [google]
8627129

>> No.8627131
File: 24 KB, 320x400, raine-sage.jpg [View same] [iqdb] [saucenao] [google]
8627131

Envelope Zelda >>8625917

>> No.8627195
File: 107 KB, 683x876, 5a4eca1beb8f7eaa2f385a77b68e49276d0d48993358065938191eb4cfc71452.png [View same] [iqdb] [saucenao] [google]
8627195

>> No.8627282
File: 75 KB, 1229x989, shelink.png [View same] [iqdb] [saucenao] [google]
8627282

>> No.8627284
File: 164 KB, 1027x899, moonbrooke.png [View same] [iqdb] [saucenao] [google]
8627284

>>8627282
(yeah "lookin' good" it's just a cruddy screenshot I found of some romhack - she's cute if you zoom it out)

>> No.8627286
File: 113 KB, 762x565, goldmoon.png [View same] [iqdb] [saucenao] [google]
8627286

>> No.8627306
File: 3 KB, 256x224, lady_link.png [View same] [iqdb] [saucenao] [google]
8627306

>>8627284

Alright it's probably this: https://www.romhacking.net/reviews/7015/
Appears to be just a trivial cosmetic hack, not a fully reworked game.

>> No.8627548
File: 16 KB, 640x480, dark_wizard_krystal.png [View same] [iqdb] [saucenao] [google]
8627548

>> No.8627575

>>8627548
Now THAT is wife material.

>> No.8627953

>>8624616
>>8624616
Indeed, its a crime.

>> No.8628352
File: 84 KB, 257x160, helba-mia.png [View same] [iqdb] [saucenao] [google]
8628352

Pff - offense is dumb anyway

>> No.8629054
File: 28 KB, 640x480, Cotton Original (PlayStation).png [View same] [iqdb] [saucenao] [google]
8629054

>>8627195
Hope you posted this one just for Silk

>> No.8629326
File: 195 KB, 1347x839, samurai_relaxing_with_lover.jpg [View same] [iqdb] [saucenao] [google]
8629326

>> No.8629351

>>8629326
her face looks familiar, like from a real person

>> No.8629374

>>8629326
SAMURAI DON'T WEAR TURBANS!

>> No.8630304

>>8614252
Dont forget arabiam moon, also who saged this thread?

>> No.8630408

>>8629374
Coming soon to 3DO

>> No.8630465 [DELETED] 

>90% of them are generic animu bitches

>> No.8630551
File: 189 KB, 1285x853, maki1.jpg [View same] [iqdb] [saucenao] [google]
8630551

Let's celebrate Maki.

>> No.8630556
File: 282 KB, 540x224, maki2.gif [View same] [iqdb] [saucenao] [google]
8630556

>> No.8630560
File: 94 KB, 805x992, maki3.jpg [View same] [iqdb] [saucenao] [google]
8630560

>> No.8630563
File: 85 KB, 200x200, maki4.gif [View same] [iqdb] [saucenao] [google]
8630563

>> No.8630565
File: 356 KB, 700x1000, maki5.jpg [View same] [iqdb] [saucenao] [google]
8630565

>> No.8630570
File: 154 KB, 540x715, maki6.gif [View same] [iqdb] [saucenao] [google]
8630570

Maki herself is celebrating.

>> No.8630574
File: 735 KB, 2000x2828, maki7.jpg [View same] [iqdb] [saucenao] [google]
8630574

>> No.8630581
File: 47 KB, 200x200, maki8.gif [View same] [iqdb] [saucenao] [google]
8630581

>> No.8630585
File: 1.25 MB, 480x320, tumblr_nq6t1zjotx1qk6v3ao4_500.gif [View same] [iqdb] [saucenao] [google]
8630585

>>8630551
Nice to see a fellow scholar.

>> No.8630593
File: 796 KB, 640x800, makic.webm [View same] [iqdb] [saucenao] [google]
8630593

>> No.8630594
File: 39 KB, 431x600, maki9.jpg [View same] [iqdb] [saucenao] [google]
8630594

>> No.8630610
File: 1.97 MB, 1100x1163, poison_and_roxy_by_robaato.png [View same] [iqdb] [saucenao] [google]
8630610

Poison my love

>> No.8630626

>>8620462
i've noticed that with 3D indie games trying for a retro style is still in an early period, a lot like back 10 years ago when most 2D indie games had pretty bad pixel art.

>> No.8630630

>>8614276
That's my wife.

>> No.8630632

>>8630626
also, a lot of people do this style but they don't get hired, because 3D indie development has actually shifted forward towards graphics-whoring and trying to give people AAA-esque experiences.

>> No.8630637
File: 1023 KB, 800x800, 98295857-F255-4D00-8331-07D1FC9390BB.gif [View same] [iqdb] [saucenao] [google]
8630637

>>8630632
A damn shame. Low poly art with modern niceties could be really great.

>> No.8630643

>>8630637
It's called hipster shit

>> No.8631079
File: 134 KB, 913x1067, Punisher_Mizuki_sprite_sheet.png [View same] [iqdb] [saucenao] [google]
8631079

Mizuki, like Lynn Kurosoawa, one of those Capcom babes stuck in license limbo.

>> No.8631554

>>8630637
looks amazing, what is it?

>> No.8631610

>>8630610
That's no lady!

>> No.8631676

>>8620576
>>8615675
the fact that there is a few dedicated autists using Ralph Bakski as model for R34 games makes me happy, also the fact that a certain project is moving fowards thanks to a few dedicate autists who took over once inusen went to make his own game

>>8620336
VG had hentai OVA so that is a big NOPE, and the original games are also Hentai.
Yuka was spared because you had her clone

>> No.8631692

>>8631610
Who gives a fuck anyway?

>> No.8631697

>>8631610
Ladyboys

>> No.8631723

>>8631697
>>8631692
>>8630610
the Gaydar went off charts, and the anons who made said posts "comes from behind"

>> No.8631731
File: 100 KB, 675x900, EEr13uWXYAA2jY6.jpg [View same] [iqdb] [saucenao] [google]
8631731

>>8631723
>>8631610
>>8631697
If Akiman says Poison's a woman, then Poison is a woman.

>> No.8631736 [DELETED] 

>>8631731
he has zero power against the chosen tribe who did that to poison, and the bandwagon artists who feeds on R34 of it.

>> No.8631745 [DELETED] 

>>8631736
Anon, according to R34 every single woman in fiction has a two feet dong and a pair of massive testicles.

>> No.8631829

>>8631731
Akiman is Japanese and within Japan being transexual is pretty much like being mentally ill and thus nothing powerful or cool/sexy can be mentally ill.;

Based Akiman and Japan

>> No.8632215

Maria Nelson >>8626352

>> No.8632275

>>8631676
The ova wasn't hentai at all.

>> No.8632368
File: 62 KB, 992x558, two_nba_players_wed.jpg [View same] [iqdb] [saucenao] [google]
8632368

Both playable in NBA Jam

>> No.8632373
File: 70 KB, 500x408, impending_annal_duel.jpg [View same] [iqdb] [saucenao] [google]
8632373

>> No.8632386
File: 37 KB, 500x436, leg.jpg [View same] [iqdb] [saucenao] [google]
8632386

>> No.8632415

>>8632275
The sequel series had an OVA that was just hentai rape but that was Viariable Geo Neo and the game was just a rape graphic novel game. Oh how the mighty have fallen

>> No.8632687
File: 382 KB, 700x1100, knuckle_heads__claudia_silva__31925805_p0.png [View same] [iqdb] [saucenao] [google]
8632687

>> No.8632732
File: 48 KB, 629x298, soft.png [View same] [iqdb] [saucenao] [google]
8632732

>>8632687
this right here

>> No.8632741

>>8632732
Oh god...

>> No.8633232

>>8630551
Could've sworn her loin cloth thing was only covering the front in the original game and you could see her ass during some of her kick animations. Am I misremembering?

>> No.8633254

>>8633232
The fucking game didn't change itself, bro.

>> No.8633570 [DELETED] 

>>8632687
Coomshit

>> No.8633785

>>8632415
>The sequel series had an OVA that was just hentai rape
Post the proof then, faggot.

>> No.8633803
File: 122 KB, 1280x720, maxresdefault[1].jpg [View same] [iqdb] [saucenao] [google]
8633803

>>8633785
They don't need to, since you can easily google for the fact that Variable Geo had a reboot in the early 2000s that rebooted everything and went back to the rape origins of the franchise, killing it forever.

>> No.8633818
File: 60 KB, 978x435, Oh Baby.png [View same] [iqdb] [saucenao] [google]
8633818

>>8632415
So where does one find this graphic novel game?
>>8633785

>> No.8633883

>>8616667
what game?

>> No.8633891

>>8631731
that's why you always play the japanese version of a game. avoiding the pozzing.
also capcom always fuck up their arcade western releases by changing difficulty and shit.

>> No.8633928
File: 66 KB, 320x256, 388411-bishi-bashi-special-3-step-champ-playstation-screenshot-press.png [View same] [iqdb] [saucenao] [google]
8633928

>>8615208
>>8615325
What about 3? Does she have a name?

>> No.8633974

>>8633928
bishi bashi has a ton of nameless random waifus

>> No.8634116
File: 88 KB, 510x624, 15048.png [View same] [iqdb] [saucenao] [google]
8634116

>>8633974
aww

>> No.8634179

>>8633883

I don't know which exact game it is, but the character appears to be Janne from World Heroes.

>> No.8634529
File: 30 KB, 285x754, Satomi_Yajima.jpg [View same] [iqdb] [saucenao] [google]
8634529

>>8633803
>>8633818
Forgot about this one lol, seriously. Also the art style for V.G. Neo, just like for the most modern animu things, blows. All those characters look awfully generic and they're supposed to be in their late teens or early twenties, with faces of 15-year-olds at best.

Also lemme post Satomi.

>> No.8634727
File: 184 KB, 675x1000, sudou3_33.jpg [View same] [iqdb] [saucenao] [google]
8634727

The Virgin H-doujin, simple crossover between Viper GTS and Variable Geo

The Chad H-doujin crossover between Viper GTS and Variable Geo, featuring Yugi from Yu-Gi-Oh!

>> No.8634730

>>8634727
Viper GT-1

>> No.8635106
File: 57 KB, 640x462, 54858745.jpg [View same] [iqdb] [saucenao] [google]
8635106

>>8633803
Yeah i love VG, but only the original OVA and the SNES / Saturn games. The rape stuff is over the top and ruins an otherwise fantastic series.

>> No.8635114
File: 610 KB, 863x1200, 76811436_p3_master1200.jpg [View same] [iqdb] [saucenao] [google]
8635114

>>8635106
I will never understand why almost all sex has to be rape. I am a fucking pervert like any guy but man, can't just 2 people fuck without one of them raping them

>> No.8635181
File: 480 KB, 1469x2046, 1645052569664.jpg [View same] [iqdb] [saucenao] [google]
8635181

>> No.8635186

>>8635181
A sad sequel.

>> No.8635206
File: 1.54 MB, 1156x1387, 1645053069186.png [View same] [iqdb] [saucenao] [google]
8635206

>>8635186
Yeah. I'm too much a fan of the first game to flat out dislike it though.

>> No.8635442

>>8635181
That's a nice ass.

>> No.8635635

>>8635442
Probably most of the game's budget went into this ass.

>> No.8635740

>>8633570
Only old men, fat brokedicks or mentally disturbed people don't coom. Sort your shit out.

>> No.8636243

>>8634727
IT'S TIME TO DO DO -DO DO DO HER!

>> No.8636849
File: 288 KB, 866x922, nana1.jpg [View same] [iqdb] [saucenao] [google]
8636849

>> No.8636851
File: 1.66 MB, 1240x1754, nana2.png [View same] [iqdb] [saucenao] [google]
8636851

>> No.8636854
File: 234 KB, 726x1000, nana3.jpg [View same] [iqdb] [saucenao] [google]
8636854

>>8623407

Tell me you've seen Musclenana before. Tell me that with a straight face

>> No.8636858
File: 143 KB, 640x480, Cel_Damage_reboot.bmp.png [View same] [iqdb] [saucenao] [google]
8636858

>> No.8636867
File: 167 KB, 1082x1200, 1632536995923.jpg [View same] [iqdb] [saucenao] [google]
8636867

I want to suck on her thighs

>> No.8636995 [SPOILER] 
File: 258 KB, 412x312, 1645113559511.gif [View same] [iqdb] [saucenao] [google]
8636995

>>8620505
>I assume this move works on other characters?
You bet it does anon.
Enjoy.

>> No.8637145

>>8629351
Emilia Clarke?

>> No.8637248
File: 2 KB, 96x128, img034.png [View same] [iqdb] [saucenao] [google]
8637248

Megapanel (Mega Drive)

>> No.8637360

>>8636995

Well hey come on what happens after that?

>> No.8637509
File: 104 KB, 600x600, qb.png [View same] [iqdb] [saucenao] [google]
8637509

>> No.8637543

>>8615363
Not an opinion i'm interested in. Move along.

>> No.8637547 [DELETED] 

Hope you all die.

>> No.8637679
File: 155 KB, 850x961, __q_bee_vampire_drawn_by_zako_arvinry__sample-56cee58c2b876af0f087022a1cecb1a1.jpg [View same] [iqdb] [saucenao] [google]
8637679

>>8637509
Milk and honey

>> No.8637694
File: 2.33 MB, 412x312, qbee 2.gif [View same] [iqdb] [saucenao] [google]
8637694

>>8636995

>> No.8637695
File: 101 KB, 875x1200, qb.jpg [View same] [iqdb] [saucenao] [google]
8637695

>>8637679

She's smiling! That makes it certain she has human emotions and would be a good mate for a human. Well, time to approach her and make myself unnecessarily physically vulnerable!

>> No.8637713 [DELETED] 

>>8637547
Why are so rude anon?

>> No.8637719
File: 1.79 MB, 1179x1275, qb.png [View same] [iqdb] [saucenao] [google]
8637719

>> No.8637749
File: 138 KB, 900x702, kittycat.jpg [View same] [iqdb] [saucenao] [google]
8637749

<< before

>>8637694 << after

>> No.8637753
File: 361 KB, 464x459, waifu thread.png [View same] [iqdb] [saucenao] [google]
8637753

>>8637694
>>8636995
this tickles my impregnation fetish.

>> No.8637804
File: 511 KB, 2374x4096, pauline.jpg [View same] [iqdb] [saucenao] [google]
8637804

>> No.8637812

>>8637804
Pauline #1

>> No.8637871
File: 137 KB, 1280x1280, stealingyourseoul.jpg [View same] [iqdb] [saucenao] [google]
8637871

>> No.8637878

>>8635114
Same here. Rape really turns me off. I don't even know why because I know it's just a fictional character and I'm not that much of a moralfag. It just kills everything for me.

>> No.8637915 [DELETED] 

>>8636867
Shes not real schizo

>> No.8637919 [DELETED] 

>>8637915

Well yes, that's one reason why anon merely wants to do it and is not actually doing it

>> No.8638025

>>8637804
is it me or is she not looking at the screen? it looks like she's looking at the left corner of the image

>> No.8638047

>>8637804
>Candy Kong's clothes
Hehe

>> No.8638154

>>8637719
kinda cute...?

>> No.8638160
File: 636 KB, 1432x1440, ark1.jpg [View same] [iqdb] [saucenao] [google]
8638160

>>8638154

Ultimately, Darkstalkers is a story about family.

>> No.8638163
File: 246 KB, 965x701, ark2.jpg [View same] [iqdb] [saucenao] [google]
8638163

>> No.8638186

>>8637878
>>8635114
There's something about the way rape is handled in hentai that is especially off putting. Even putting aside any morality to it because it's all just cartoons anyway, but it's usually just really really stupid. The victim will say shit like "no I'm a virgin!" and then within 20 seconds start to like it. I don't think there is even a single instance of a rape in hentai where the girl remains combative throughout.

>> No.8638218

>>8638186
This is why I dislike most of Samus Aran r34 art. She is supposed to be a stone cold warrior bitch, yet whenever she is depicted with another creature she is usually drawn like a helpless rape victim. You would expect her to bite off at least five tentacles with her teeth alone before she breaks.

>> No.8638280

>>8638218
The crippling insecurity of most anime fans requires extreme passiveness on the part of every woman that is a sexual target. Their fragile egos can't handle anything else. I don't remember the show's name but I remember hearing that there was a collective bitch fit in Japan when a popular show dared to allow one of the waifus to have consensual sex.

>> No.8638292

>>8638280
Anime and manga fans are enormous faggots and I can't stand them

(t. anime and manga fan)

>> No.8638376
File: 296 KB, 2000x1161, ECVeCgIU4AMVtdL.jpg [View same] [iqdb] [saucenao] [google]
8638376

>>8638280
Japanese Otaku and most Japanese men. They need their women weak and conquered in all situations.

Anyhow enough about those losers

Enjoy the 3 Western versions of Zelda
(Captain N, Super Mario Bros Super Show, CD-I)

>> No.8638413

>>8635114
>>8637878
>>8638218
>>8638280
>>8638292
>>8638376
Go back to reddlt

>> No.8638435

>>8623667
I wish there's three kind of endings based on time.
1. If you reach the girl less than X hour, she will not be touched
2. If you reach her between X and X hour, you will find her getting gangbanged
3. If you need more than X hour to reach her, you will find her alone covered in cum.

>> No.8638437

>>8624806
I remember back then my fap material are either American Comics or Video Game ads like Battle Arena Toshinden. PSM magazines also releasing a lot of amazing fap material.

>> No.8638453

>>8637878
Not a video game example but it's part of the reason I can't really get into most of Zone's stuff - you have goofy shit like the Foster's one and the Midna one where she definitely seems to enjoy it, then you have the Jenny and Raven ones where they outright get raped. Doesn't help that these characters are all officially minors. Won't be surprised if he acts out on that one of these days.

>> No.8638467

>>8630551
Those henchwomen need love too

>> No.8638482

uuh..
*sploop*

>> No.8638517

>>8638435
I think there's a game called Riot City that does something like that. The kidnapped girlfriend (Catherine) is one of those "blondes in a red dress" like Marian and Jessica, but if you beat the game in one credit, she shows up wearing lingerie instead.
https://youtu.be/1DOmNs85VL4?t=3300

>> No.8638601

>>8638435
Funny you say that because I had a similar idea but a combination of Capcom's D&D beat-em-ups with a dark spin on Mega Man's robot master system and Super Mario's "your princess is in another castle". Basically your starting location depends on which characters you play as and the map is sprawling. You have different paths through the game with multiple last bosses. You have to beat all of the bosses to finish the game but the castle the girl is actually being kept prisoner in is randomized. You can either beeline to the bosses hoping that you guess right or take a more circuitous route to gather information by interrogating the bosses' various minions, who are effectively the game's minibosses. Your interrogation tactics will determine how successful you are at getting good intel. Depending on which boss is holding the princess and how long it takes you to find her will determine her fate.

>> No.8638907

>>8638413
stop replying to bait

>> No.8639057

>>8635106
>Yeah i love VG, but only the original OVA and the SNES / Saturn games.
The SNES game is meh, especially when you to play it against the CPU. Right off the bat in the Normal mode you face off against Chicho, whose AI is ludicrously cheap. She's constantly using that leap attack (forgot the name) or sliding and you get easily BTFO even on lower difficulties. Satomi is also equally cheap, I had less problems beating Reimi lol.

The best game in this series is Advanced V.G. 2. It's still a SF2 with some KoF thrown in, but I like it more. In fact, I wasn't a fan of fighting games until A.V.G. 2.

Also Tamao could be my younger sister.

>> No.8639304

>>8638435
Kichikuou Rance, while not a side-scrolling beat 'em up, has a comparable feature.
If you do not rescue Sill and Soul Less from the prison within a specific number of turns, you will discover that they were gangraped to death when you conquer the prison.
(I'm very sure a feature like that will be present in other turn-based eroges or JRPGs eroges as well.)

>> No.8639384

>>8638601
Imagine you enter a castle at random and accidentally found the princess.

>> No.8639801
File: 449 KB, 1269x1357, tmnt_aska.jpg [View same] [iqdb] [saucenao] [google]
8639801

Tried skimming DeviantArt briefly just now, but it's mainly Bowsettes and Samuses and such I guess

>> No.8639803
File: 453 KB, 810x1080, katt.jpg [View same] [iqdb] [saucenao] [google]
8639803

Can't go wrong with Katt though

>> No.8639810
File: 186 KB, 1280x905, cameela.jpg [View same] [iqdb] [saucenao] [google]
8639810

Apparently this character was in Shining Force II, though I do not remember

>> No.8639818
File: 130 KB, 621x859, MAKESURETOCREDITTONBERRY2K.jpg [View same] [iqdb] [saucenao] [google]
8639818

>>8639810
Hm ok well here we go then

>> No.8639827
File: 108 KB, 685x900, mishaela.jpg [View same] [iqdb] [saucenao] [google]
8639827

Oh and here's some other one, from Shining Force 1. She wasn't as pretty in the game apparently, but everybody had weird pointy faces in that game so maybe she was still supposed to be hot in-universe

>> No.8639830
File: 195 KB, 400x500, moonbrooke.jpg [View same] [iqdb] [saucenao] [google]
8639830

>> No.8639839
File: 123 KB, 600x750, you_are_uninvited.jpg [View same] [iqdb] [saucenao] [google]
8639839

Multiple fanart works for this character, surprisingly.

>> No.8639842
File: 191 KB, 1033x1032, belle.jpg [View same] [iqdb] [saucenao] [google]
8639842

Another one for the osteophiles

>> No.8639847
File: 225 KB, 1236x820, guardian.jpg [View same] [iqdb] [saucenao] [google]
8639847

>> No.8639851
File: 202 KB, 1235x821, guardian.jpg [View same] [iqdb] [saucenao] [google]
8639851

>> No.8640012

>>8639801
>DeviantArt

15% Good drawings
25% Acceptable fetish fueled drawings.
60% Disgusting fetish fueled drawings. And no, not waxplay or a riding crop on the ass, but anything along the lines of, "Hey! I have the drawing skill of a six-year-old retard, and I am going to draw this character suffering from hyper pregnancy. Yes, her big feet are dirty and stinky!"

>> No.8640043
File: 47 KB, 500x647, 1567788764.jpg [View same] [iqdb] [saucenao] [google]
8640043

>> No.8640158

>>8639847
>>8639851
Finally some good art of her

>> No.8640229

>>8639851
huh.. so that's uh how that works

>> No.8640245
File: 421 KB, 632x431, 7e4.png [View same] [iqdb] [saucenao] [google]
8640245

>>8640229
Actually there in the manual (Japan only)

>> No.8640246
File: 734 KB, 1165x900, 53731961_p0.jpg [View same] [iqdb] [saucenao] [google]
8640246

>>8640158
There's more than you'd think but you have to know where to look.

>> No.8640572
File: 210 KB, 1236x819, guardian.jpg [View same] [iqdb] [saucenao] [google]
8640572

>>8640158

Dude has a few others there, including a couple of mildly NSFW ones (censored on DeviantArt, dunno how to get around that, maybe Patreon or something) but the first one I posted is the best in my opinion

>> No.8640610
File: 177 KB, 935x1400, Soul &amp; Sword no Subete (Strategy Guide)(Scan)(JP)(SFC)_0009.jpg [View same] [iqdb] [saucenao] [google]
8640610

Twin loli mages from Sword & Soul. The guide lists their ages as a mystery mark, so I bet the twist is that they're both over a 1000 years old.

>> No.8640623
File: 177 KB, 936x1400, Soul &amp; Sword no Subete (Strategy Guide)(Scan)(JP)(SFC)_0007.jpg [View same] [iqdb] [saucenao] [google]
8640623

>>8640610
The main heroine is pretty hot too. Looks a bit too grown up to be 15 though.

>> No.8640641
File: 189 KB, 1024x1707, tillis_burning_rangers.jpg [View same] [iqdb] [saucenao] [google]
8640641

>> No.8640908
File: 952 KB, 1946x2738, IMG_20220218_222458.jpg [View same] [iqdb] [saucenao] [google]
8640908

>>8639847
>>8639851
>>8640245
>>8640246
>>8640572
>Guardian Legend
I made this fanart of her few months ago: Not the best one, but still fanart.
BTW: Does she have a name? I'm searching around with no results

>> No.8640957

>>8640908
The localized manual calls her "The Guardian", but the Japanese manual calls her System D.P., or Miria, as shown here.>>8640245

>> No.8640968
File: 183 KB, 1677x799, Miria_5_by_hinomars19.jpg [View same] [iqdb] [saucenao] [google]
8640968

>>8640908
Same image from the manual lists her designation as "System D.P." with a nickname of ミリア. There's multiple ways you could translate that, but the general consensus for the Guardian Legend fandom is "Miria".

>> No.8640997

>>8640957
>>8640968
Good to know
Thanks for the info anon

>> No.8641043
File: 309 KB, 2048x1288, Guardian_Legend_Miria_with_big_boobs.jpg [View same] [iqdb] [saucenao] [google]
8641043

>>8640997
Incidentally the name "Alyssa" pops up now and again but that's entirely invented from a badly written fanfic circa 1999. That it lingers on to this day is kind of impressive.

>> No.8641091

>>8639803
does she go to the bathroom?

>> No.8641102
File: 248 KB, 559x805, __aska_teenage_mutant_ninja_turtles_and_1_more_drawn_by_diepod__4459efc3d1261a60a358ea5a5b96e5e8.png [View same] [iqdb] [saucenao] [google]
8641102

>>8639801
might have better luck with a booru

>> No.8641114
File: 201 KB, 800x597, taki_wins.jpg [View same] [iqdb] [saucenao] [google]
8641114

>>8641043

Well those are some ripe curves. What is she anyway, a robot?

>> No.8641127
File: 73 KB, 600x480, transcending.jpg [View same] [iqdb] [saucenao] [google]
8641127

>> No.8641578

>>8640908
cute

>> No.8641643

>>8641127
I love how her name sounds

>> No.8642204
File: 210 KB, 1920x872, weston-reid-shadow-hp-03.jpg [View same] [iqdb] [saucenao] [google]
8642204

>> No.8642294
File: 163 KB, 576x432, ArielVisual13[1].jpg [View same] [iqdb] [saucenao] [google]
8642294

>>8641114
The lore is incredibly vague and ill-defined, even with the Japanese manual factored in, but she's apparently described as a cyborg. Beyond that, there's little else. I guess since she's classified as a cyborg, it does answer the question of what her size is. She has a lot of design details in common with ARIAL, who is actually building sized, so one could imagine Miria also might be larger than human due to her whole turning into a space fighter jet.

>> No.8642448
File: 1.63 MB, 2448x3264, 20210313_205723.jpg [View same] [iqdb] [saucenao] [google]
8642448

>>8642294

>> No.8642460

>>8641102
Any good drawfags?

>> No.8642478
File: 178 KB, 1286x1691, Cameelaconcept.png [View same] [iqdb] [saucenao] [google]
8642478

>>8639810
>>8639818
I had a massive fucking crush on her as a kid, and I so badly wanted to save her. Fuck you Geshp

>> No.8642493

>>8642204
now this kind of women is what i like

>> No.8643071
File: 2.45 MB, 3433x4519, cameela_shining_and_1_more_drawn_by_rejean_dubois__fbb52ad8af8936a1a50fc18b3d8401b4.jpg [View same] [iqdb] [saucenao] [google]
8643071

>> No.8643078
File: 3.70 MB, 1240x1754, mishaela.png [View same] [iqdb] [saucenao] [google]
8643078

>> No.8643080
File: 623 KB, 965x965, mishaela2.jpg [View same] [iqdb] [saucenao] [google]
8643080

Unnamed female assassin from Killer Instinct the Collectible Card Game: >>8640478

>> No.8643084
File: 1.62 MB, 1151x1718, matilda_shining_and_1_more_drawn_by_namatamago_s__623fad41377871b1f00f1d9156f16ff0.jpg [View same] [iqdb] [saucenao] [google]
8643084

Some random super-cute centaur

>> No.8643509

>>8643080
Looks like a proto-Joanna Dark.

>> No.8643560
File: 343 KB, 594x842, nana.png [View same] [iqdb] [saucenao] [google]
8643560

Time for slightly more Nana

>> No.8643562
File: 250 KB, 500x500, nana.jpg [View same] [iqdb] [saucenao] [google]
8643562

>> No.8644547
File: 295 KB, 450x450, spiral.gif [View same] [iqdb] [saucenao] [google]
8644547

>> No.8644931
File: 553 KB, 781x1105, white_mage.png [View same] [iqdb] [saucenao] [google]
8644931

>> No.8645235
File: 151 KB, 513x804, 40.png [View same] [iqdb] [saucenao] [google]
8645235

For me, it's HFYRI.

>> No.8645241
File: 234 KB, 1920x1080, 983869-gallery5.jpg [View same] [iqdb] [saucenao] [google]
8645241

>>8645235
look how they massacred my girl

>> No.8645273 [DELETED] 
File: 167 KB, 348x510, R(2).jpg [View same] [iqdb] [saucenao] [google]
8645273

>>8645235
>>8645241

>> No.8645452 [DELETED] 

>>8645273
You win the internet sir

>> No.8646493
File: 658 KB, 468x967, BoFII_NinaArtwork.png [View same] [iqdb] [saucenao] [google]
8646493

>> No.8646590

>>8646493

I've always liked that rendition of Nina.

>> No.8646886

>>8645235
>>8645241
Not retro

>> No.8647089

Beer goggles
On>>8645235
Off>>8645241

>> No.8647126

>>8645235

Is this the wrong aspect ratio or something? She looks wide.

>> No.8647324
File: 41 KB, 450x575, 1628043637053.jpg [View same] [iqdb] [saucenao] [google]
8647324

>>8645235
>>8645241
Both look terrible

>> No.8647807

>>8619256
>>8619332
>>8624908
Her design from Gameboy onwards is legitimately stellar. But even the old look with the blond hair is not bad either. How did they nail it almost immediately?

>> No.8647830
File: 40 KB, 758x566, Virtual Boy Wario land.jpg [View same] [iqdb] [saucenao] [google]
8647830

The bunny girl Wario picks up in some best endings of Virtual Boy Wario Land. She has no name, no official art and is never seen again.

>> No.8647865
File: 40 KB, 365x367, 4079D604-A4F0-481E-9730-07A70A393740-1.png [View same] [iqdb] [saucenao] [google]
8647865

>>8647807
Because the "classic bombshell look" never goes out of style

I am so glad Mario Odessey opened up the floodgates for her to be a thing now with all other Mario products from Tennis, to Golf to Mario Kart and beyond.

>> No.8647876

>>8616534
In the Narnia books centaurs had both human and horse stomachs. They had to eat human food then oats and hay to satisfy both.

>> No.8647882

>>8647807
Restrictions breed creativity. When you have to create a visually attractive character but also keep it strictly family friendly, you often end up with more genuinely pleasing results compared to unrestricted designs.

>> No.8648063

>>8647830
This is what they took away from you. Anyone who supports modern gaming should not be allowed to post here.

>> No.8648268

>>8622990
I wish FS made more doujins.

>> No.8648424

>>8640012
Have a big belly fetish (fat or pregnant, depends on how wholesome I’m feeling) and can confirm, most the stuff there is utter trash

>> No.8648451
File: 251 KB, 800x1035, 1484074091578.png [View same] [iqdb] [saucenao] [google]
8648451

>>8647807
>How did they nail it almost immediately?
Because Yoichi Kotabe is a God-tier illustrator. Admittedly his design draws moreso from the cabinet/flyer art design of Pauline, where she wears that tight red dress, than the in-game sprite from Donkey Kong '81 with the old-timey dress.

Still, his Peach, while cute, didn't do much for me, yet there's something irresistible about Pauline.

>> No.8648510

>>8644547
6 armpits

>> No.8648536
File: 8 KB, 390x573, EM9Q_xRXkAEvL7x.png [View same] [iqdb] [saucenao] [google]
8648536

>> No.8648567

>>8640012
>>8648424
To be fair, waxplay and and riding crops are a disgusting fetish too.

>> No.8648568
File: 1.19 MB, 1266x1785, 1639946084167.jpg [View same] [iqdb] [saucenao] [google]
8648568

Best girl

>> No.8648674
File: 39 KB, 238x253, 6 bullets.png [View same] [iqdb] [saucenao] [google]
8648674

>>8648510
This is the greatest armpit ever made. The Spiral Single Action Armpit
Six armpits. More than enough to job any dick that moves.
I love to lick armpits after battle. There's nothing like the feeling of slamming a long silver tongue into a sweaty armpit.

>> No.8649064

>>8648510
ponder the odor

>> No.8649312
File: 224 KB, 1200x2270, 01c67bb920220c4e4d2677b43bf1a465.jpg [View same] [iqdb] [saucenao] [google]
8649312

>>8648568
Hard to choose: Vampire have lots of qt's.
Anyway, good choice

>> No.8649318

>>8648536
who's she?

>> No.8649352

>>8649312
Damn, those legs... why are we even attracted to long legs?

>> No.8649357

>>8649318
Gloria Chamberlain from Gundam The Battle Master 2

>> No.8649362

>>8636849
Cool art style but man, what an absurd concept. Nobody will undress on North Pole in a middle of fucking blizzard. At least draw her inside igloo or something

>> No.8649376

>>8649362
No, she's perfect that way

>> No.8649479
File: 250 KB, 575x771, 12236311_p0_master1200.jpg [View same] [iqdb] [saucenao] [google]
8649479

>>8647830
- Bunny Suit
- Blonde
- The Smile... Probably a lighter hidden in her cleavage.

I would have sketched Elirin and Wario together if I could draw at all.

>> No.8649494
File: 42 KB, 480x360, hqdefault.jpg [View same] [iqdb] [saucenao] [google]
8649494

>>8649318
She can pilot my BALL anythime.

>> No.8649742
File: 39 KB, 600x600, N2128325001002_006.jpg [View same] [iqdb] [saucenao] [google]
8649742

>>8649494
God damn I love the Ball. 180mm cannon zipping around at breakneck speed is a beautiful thing to see in action.

>> No.8649748

>>8649479
>_master1200.jpg
I thought you loved your wife.

>> No.8649957
File: 131 KB, 790x790, arcana_teefa.jpg [View same] [iqdb] [saucenao] [google]
8649957

>> No.8649963
File: 309 KB, 650x568, arcana.jpg [View same] [iqdb] [saucenao] [google]
8649963

>> No.8650029

>>8616469
>woman
kill yourself retard fag

>> No.8650068
File: 771 KB, 1000x1000, 36317766_p0.jpg [View same] [iqdb] [saucenao] [google]
8650068

>>8648451
She predates everyone on this thread but she is still the most classic and enduring. So happy she is back in the spotlight.

>> No.8650072

>>8648451
It makes sense that she looks like that. Mario is fundamentally based on golden age cartoons like Mickey Mouse and Felix the Cat so his girlfriend resembling a lounge singer fits perfectly.

>> No.8650076

>>8650068
Foreman Spike is about to go mainstream in the upcoming film. Suck it, Stanley the Bugman.

>> No.8650085

>>8650076
That film is going to be so adequate that it'll be boring.

>> No.8650101

>>8617603
>That face
Jesus.

>> No.8650112
File: 477 KB, 900x1200, __draco_centauros_puyopuyo_and_1_more_drawn_by_sakuramau__f7cc82107c1995593101ad07a1cd7d82.jpg [View same] [iqdb] [saucenao] [google]
8650112

>>8614252
GAO GAO

>> No.8650131
File: 28 KB, 384x447, vs2-6b.png [View same] [iqdb] [saucenao] [google]
8650131

In honor of that shot getting removed from the Capcom Fighter Collection

>> No.8650245

>>8617409
What gaem?

>> No.8650268

>>8622348
ohhh yeah

>> No.8650404

>>8650245
See>>8614705

>> No.8650479

>>8650085
My only hope for the film is that it pushes Nintendo to break the ongoing status quo in Mario universe and return back to GameCube's experimental days when narrative was more prevalent in Mario media.

>> No.8650486
File: 124 KB, 333x194, 1617079408764.png [View same] [iqdb] [saucenao] [google]
8650486

>>8614705
>>8650404
>Wikipedia screenshot
Dam.

>> No.8650489
File: 140 KB, 581x900, ET-GUHrXQAEcSzE.jpg [View same] [iqdb] [saucenao] [google]
8650489

>>8650072
I wonder if this Yoichi Kotabe drawing of Lady was actually drawn for a Mario Encyclopedia book. I get the impression this was actually drawn for Donkey Kong '94 back when Pauline still had her "Lady" look.

>> No.8650618

>>8630594
That guy's art is pure sex.

>> No.8650626

>>8640012
The fuck is riding crops?

>> No.8650635

>>8643084
>Random
That's May, bud.

>> No.8650660
File: 85 KB, 993x616, 1645480372225.jpg [View same] [iqdb] [saucenao] [google]
8650660

>>8649479

>> No.8650680
File: 2.15 MB, 960x1280, gunbird.png [View same] [iqdb] [saucenao] [google]
8650680

I was playing Gunbird the other day, good game.

>> No.8650706

>>8650680
>Double nip-slip
Holy based

>> No.8650713
File: 2.07 MB, 960x1280, gunbird-2.png [View same] [iqdb] [saucenao] [google]
8650713

>>8650706
Indeed.

>> No.8650715

>>8650068
We need a series about forgotten or failed characters. Depicted as if they're celebrities that no longer or waning popularity.

>> No.8650719

>>8650131
Fuck, they start censoring things now?

>> No.8650768
File: 102 KB, 167x255, mina_majikina1.gif [View same] [iqdb] [saucenao] [google]
8650768

>>8650635

Oh I see, the "Matilda" came from the Japanese version I guess. That's what had thrown me off.

>> No.8650769
File: 56 KB, 207x219, mina_majikina2.gif [View same] [iqdb] [saucenao] [google]
8650769

>> No.8651087
File: 88 KB, 1151x801, 3dwasamistake.jpg [View same] [iqdb] [saucenao] [google]
8651087

>> No.8651091

>>8650626
Genzoman

>> No.8651123

>>8650626
>>8651091
Sorry, meant for >>8650618

>> No.8651138
File: 34 KB, 970x600, RIDING CROP.jpg [View same] [iqdb] [saucenao] [google]
8651138

>>8650626
This thing.

>> No.8651408

>>8650131
wow, are you serious? they censored it?
also that quote is peak globohomo

>> No.8651419
File: 4 KB, 207x262, 1169.png [View same] [iqdb] [saucenao] [google]
8651419

>>8650680
same energy

>> No.8651470

Kawasaki water gear model >>8640887

>> No.8651489

>>8633818
the english dub is kinda funny
>Oh your gonna rape me huh?

>> No.8651548

>>8651489
The English dub is your classic round up some random people from a low tier anime con and get them to work for free over the next 2 days

"HEY WANT TO BE AN ANIME VOICE ACTOR!?"

>> No.8651568
File: 49 KB, 518x680, 1632634043671.jpg [View same] [iqdb] [saucenao] [google]
8651568

>>8651489
>>8651548
None of the English dub actors are credited for that very reason; free work belted out over a con weekend in a hotel room, weeb get to say they dubbed an anime.

>> No.8651645

>>8651548
horrible hentai dub work makes a lot of stuff watchable.

>> No.8652092

>>8651408
Yeah, they removed all alternate endings

>> No.8652409

>>8652092
Guess i'll stick with the ogs then, no need to play an inferior product. Thanks for the warning

>> No.8652425

>>8652092
I don't even give a fuck about endings in fighters but now I know this I will be boycotting this product.

>> No.8652479
File: 370 KB, 566x800, Yuffie J.png [View same] [iqdb] [saucenao] [google]
8652479

>>8651419
Room for more Yuffie ITT

>> No.8652790
File: 348 KB, 1534x1534, yuf.jpg [View same] [iqdb] [saucenao] [google]
8652790

>>8652479

She is slender so there is room for multiple ones

>> No.8652825
File: 1.10 MB, 750x1000, dact37o-02975e30-4114-4338-9720-47e3a421c5aa.png [View same] [iqdb] [saucenao] [google]
8652825

>>8652479
Really like how she looks in KH1, and her VA

>> No.8653090
File: 1.89 MB, 1899x829, 6bf07f_158e01e01aa8482ab320f36bcb76696c~mv2.png [View same] [iqdb] [saucenao] [google]
8653090

>>8623953
It's actually with a different publisher now:
https://www.valis-game.com/

They had just released the PC Engine versions of Valis I, II, and III on the Switch with English subs and the original Japanese voices.

Hope they eventually do the same with the PC Engine version of Valis IV.

>> No.8653148

>>8623953
that eroge never happened

>> No.8654339
File: 138 KB, 311x566, Fanha_Artwork.jpg [View same] [iqdb] [saucenao] [google]
8654339

>> No.8654414

>>8654339

Is that official art? She's got huge boobs.

>> No.8654480
File: 49 KB, 1080x771, FKu8XDVWUAAes35.jpg [View same] [iqdb] [saucenao] [google]
8654480

>>8652825
>Buttoned shorts

>> No.8654703

>>8654339
imagine the breeze

>> No.8654837
File: 803 KB, 540x803, tumblr_pqeh5i14Mz1tu022ro3_540.png [View same] [iqdb] [saucenao] [google]
8654837

>>8625086
Chibi Marian from the Japanese Double Dragon III instruction manga.

>> No.8654982
File: 415 KB, 1067x337, lmao.png [View same] [iqdb] [saucenao] [google]
8654982

>>8650131
>>8650719
>>8651408
it's real, but plural indicates that both secret endings are being removed, where one of them was tame. So I don't think they were removed for sexual reasons, as they would have just targeted the Morrigan/Lilith one.

https://www.capcom-games.com/cfc/en-us/title/vampire-s2.html

>> No.8654995

>>8654982
If they did remove it for sexual reasons it's probably because they don't want a product that has a Street Fighter II game in it to get an M rating.

>> No.8655004

>>8616138
WHY AM I JUST NOT NOTICING THOSE BOOTS GOING ALL THE WAY UP TO HER THIGHS AND THE HINT OF NO PANTIES

>> No.8655008
File: 122 KB, 300x189, 1603899063394.png [View same] [iqdb] [saucenao] [google]
8655008

>>8651408
kek, now that you mention, it absolutely is.

>> No.8655016
File: 160 KB, 640x480, The dog is wearing more clothes than Lana.jpg [View same] [iqdb] [saucenao] [google]
8655016

Princess Lana was one of my earliest TV crushes.

>> No.8655229
File: 509 KB, 741x1800, FK6ZGk9VgAIF434.jpg [View same] [iqdb] [saucenao] [google]
8655229

>> No.8655235
File: 162 KB, 800x791, 183884-darkstalkers-3-playstation-front-cover.jpg [View same] [iqdb] [saucenao] [google]
8655235

>>8654982
>it's real, but plural indicates that both secret endings are being remove
It's probably just a typo or they meant can't be reach, no matter which character.

>>8654995
It was tame enough for the PlayStation port back in 1998 to get a T-rating, but it's too raunchy for today's standards, seeing how the prudes have taken over the industry.

>> No.8655461

>>8655016
what does the N stand for?

>> No.8655465

>>8655461
Nipples

>> No.8655470

>>8655235
It's actually probably for CERO concerns, not ESRB. Japan has gotten a lot stricter over the last few years.

>> No.8655476

>>8623953
I don't mind the eroge adaptation, but the eroge suck ass. I was hoping for a better eroge storyline and "storyline"

>> No.8655489

Since we already dab into eroge, I miss my first eroge. I don't even remember the title, just set in typical high school and I love the girl with long black hair that also a swimmer and wear skintight mizuno swimwear. I wish there's a list of retro eroge

>> No.8655571

>>8654837
Extra cute.

>> No.8655843

>>8655470
>Japan has gotten a lot stricter over the last few years.

Why tough?

>> No.8655976

>>8655489
If you had played one of the few English-translated old eroge, it would have been "Season of Sakura" or "True Love."
I'm not aware of any other old translated school-setting eroge.

>> No.8656083
File: 557 KB, 743x1091, alpha1.jpg [View same] [iqdb] [saucenao] [google]
8656083

I wonder if Square still remembers their first female protagonist.

>> No.8656283

>>8655489
Sakura swim club?

>> No.8656298
File: 91 KB, 421x600, D4iqhNcUIAUNJzg.jpg [View same] [iqdb] [saucenao] [google]
8656298

The chick from those Game no Kanzume compilations is pure sex.

>> No.8656306
File: 70 KB, 960x466, D4iqgTgUcAAj0zM.jpg [View same] [iqdb] [saucenao] [google]
8656306

>> No.8656307
File: 49 KB, 640x598, D4iqfIhUYAE-sVG.jpg [View same] [iqdb] [saucenao] [google]
8656307

>> No.8656334

>>8655843
boomers and SJWs

>> No.8656336

>>8655976
Nope, not both of em
I believe I found it from a pirated CD-ROM full off pirated games. The title of the CD is King of Games and the the game list is a mix of English and Chinese. Probably pirated CD from Hong Kong or Malaysia.

>>8656283
No, it look too modern. Also it's not focusing on swim club. There's three girls, the other two got different club to go to. Only the long black haired one went to swim club

>> No.8656381

>>8656334
note in Japan there's a remarkable overlap between the two

>> No.8656503
File: 41 KB, 400x298, 1640325781596.jpg [View same] [iqdb] [saucenao] [google]
8656503

>>8655843
A lot of western SJW feminists moved to Japan to change the industry from the inside and much like what happened in the West, lonely Japanese male programmers will jump at the chance to talk/have sex with a woman (hell a WHITE woman) and much like every great empire, the woman will tell the emperor terrible advice and steer that ship into destruction for their own intentions.

It's a tale as old as time and we never learn.

>> No.8656597

>>8655843
CERO is filled with the Japanese equivalent of soccer moms.

>> No.8656615

>>8656503
I don't get this mindset, they like jap culture/media, but they go there to change it into something else, something that resembles western media. Wtf is the point? why not just stick to ruining your media back home if you just want to turn every show into western like shows? it's unironically killing diversity, and just turning everything generic, anything unique slowly being stripped away.
The whole reason so many people flock to it is because it was their japanese thing that made it so attractive to consume n the first place, not turning it into another product that's the same sanitized crap from where you come from...

>> No.8656628

>>8656503
Not many SJW can move to Japan and find Japanese husband. Japanese men want more traditional wife and those feminists don't fit their criteria

>> No.8657128

>>8656503
Retard can't see Japan wants to market its stuff and has to conform to the world standards and is dragging itself kicking and screaming to fit them. Look at how much during the Olympics they worked hard to go OH MAN HIDE THE SHIT THE GUESTS ARE COMING so they wouldn't be the hahawackypantiesvendingmachine guys.

>> No.8657149

>>8656628
And you think therr are no japanese socialists?

>> No.8657286
File: 459 KB, 911x1627, 1640488451289.jpg [View same] [iqdb] [saucenao] [google]
8657286

>>8656615
Do you know what it's like to be a self hating SJW? Do you know what it's like to destroy friendships, never talk to your birth parents and stay inside all day scrolling various social media feeds while getting angry over nothing?

And you are surprised they would want to destroy something you think they enjoy........

These are some of the most mentally broken people in the world, but because of the internet we think they are normal and hire them because we don't have enough time to get to know that they are psycho.

>> No.8657327
File: 30 KB, 594x425, Otoya-Yamaguchi.jpg [View same] [iqdb] [saucenao] [google]
8657327

>>8657149
are there?

>> No.8657403
File: 1.38 MB, 930x530, Tokyo Olympics 2020.webm [View same] [iqdb] [saucenao] [google]
8657403

>>8657128

>> No.8657526

>>8657403
I love how for the Tokyo 2020 Olympics they were going to use Mario as their mascot.

A fucking Italian plumber from Brooklyn.

>> No.8657649

>>8657327
A true hero, he deserves a statue and to be commemorated widely.
>>8657403
Hah, the JAV pool being destroyed was a nice touch.

>> No.8657721

game counselor >>8656946

>> No.8657743
File: 788 KB, 540x803, tumblr_pqeh7pP0c11tu022ro1_540.png [View same] [iqdb] [saucenao] [google]
8657743

>>8655571
One last image before the thread dies. No wonder the Lee boys are always fighting over her.

>> No.8657858

>>8657128
I guess covid scare helped keep Japan being Japan eh

>> No.8657892

>>8657858
It's a miracle.

>> No.8657912

>>8657149
Japanese socialist is far more hardcore than weaklily American socialist who only have power on twitter or protesting in safe American cities where the country protecting their right.

I remember a video where an American karen visit another country, record a video and the family of local refuse to be recorded and the karen screams "First amandment!" and she got beat up

LOL I found the video!

https://www.youtube.com/shorts/FiRPn_6uvtI

>> No.8657920

>>8657403
What anime is that?

>> No.8658167

Christina Ricci is /vr/ https://www.youtube.com/watch?v=9y8RkKe68tg

>> No.8658175

>>8658167
It's like they took the engine and graphics form Clock Tower and turned it into a family shovelware game

>> No.8658228

I don't get it, Nagatoro raw post got over 1000 posts but not saged, but this one got 500 posts and it can't be bumped back up? I don't understand 4chan system sometimes.

>> No.8658272

>>8616407
>I will never understand the appeal
The appeal is boobs