/sci/ - Science & Math

>>11330361
No man, this one is bad for real.

>>11330361
Probably, no worse than swine flu a few years ago. The sample size is still really small. The 3% death rate has already dropped to 2% and should go down from there as more people get it. Zika is like 8%, SARS is 14%, MERS is 35%, H5N1 is 60%, and Ebola is 90%. The further you go back in the news the more disease scares there are.

>>11330391
Thanks, i do agree that they like to blow things out of proportion. Deaths are only in single digits , yet so much news about it..

>>11330361
isn't it like 1,5% mortality?

It's just a flu variant. You fucking idiots are so god damn stupid.

>>11330422
yeah, cause flu variants can't kill tens of millions in a year (not saying this one can)

>>11330391
Where the hell are you getting those numbers? Ebola has a mortality of about ~50% as going by the latest epidemic. Going by that, i can't trust your numbers at all.

It doesn't even kill white people

>>11330427
on global average, yes its around 50%, but it varies across outbreaks.

>>11330426
That isn't the point. Yes, the flu can kill. Yet the people doom saying about bioweapon memes and the end of the world are fucking annoying. After visiting /pol/ i'm certain that this is the source of the retardation regarding the virus because of obvious anti-china sentiments coupled with lack of medical and public health knowledge.

For example, people keep bringing up "muh 40 million quarantined" yet they ignore that this isn't because the government suddenly decided to put 100 cities and towns on lock down, its because the few that got quarantined are very large, densely populated, areas. Not only that but population sizes and living density is a completelt different beast in China in comparison to a country like the USA. in the USA there might not have been a need to actually quarantine a city like this because there aren't as many people, and they aren't as tightly packed, making the virus not spread as quickly and easily. For China it seems more like a smart thing to do.

>>11330439
None of them do. Guess why ? :)

>>11330380
What makes you think that?

>>11330444
>/pol/
they are more retarded than /b/ from what i remember

>>11330444
/pol/ just can't wait until the end of the world

>>11330412
Double digits, anon. Like your iq

The death rate is 50% and it will be around 10% to 50% on first world countries.
The death rate formula that is being used is (Ndeaths/Ninfected). The problem with this formula is that the infection is exponential and a lot of people in the Ninfectet group weren't given enough time to die.
If you calculate the death rate with the formula (Ndeaths/ (Ndeaths+Nrecovered)) the death rate is slightly over 50%.

>>11330465
rude

>>11330391
Depends on the strain of Ebola, I think Zaire was 90% most recent was 60%

Going to the hardware store. What mask and goggles should I buy ?

Also why the mortality isn’t counted by comparing the number of dead and the number of infected ?

>>11330427
>>11330479
Doesn't matter, the % changes as it spreads. Media gives you the tip toppest top number possible for extra fear points.

>>11330479
the 90% mortality ebola outbreaks were literally in shithole villages with no knowledge of medicine

>>11330465
How is not keeping up to date with the latest statistics of some minor flu allowing you to judge my IQ jimbo? Or are you just trying to be offensive to strangers online because you haven't got better things to do with all that free time on your hands?

>>11330482
Dude it doesn't do anything. Only killed 41 people

>>11330361
In China here, currently with stomach and intestine problems (not the coronavirus). How do I increase my chances of not getting double-rekt?

>>11330469
>If you calculate the death rate with the formula (Ndeaths/ (Ndeaths+Nrecovered)) the death rate is slightly over 50%.

>>11330380
>No man, this one is bad for real.
Just like every other one

>>11330391
>3% death rate has already dropped to 2%
It's fluctuated between 1.8%-3%, currently around 2%. It really does seem to be stable around there.
Viral mutation could do anything though so there's room for it to get much worse. Coronaviruses aren't especially conservatory in their genes, they can mutate and cross-over wildly, it's how this epidemic started.

>>11330417
stable at around 2%

>>11330426
>>11330422
>flu variant
Technically a cold variant.

>>11330543
>How do I increase my chances of not getting double-rekt?
gloves, masks, goggles. Do not touch your face in any way.
After returning home and removing mask etc, still do not touch your face until you've washed hands, then wash everything else. Wear covering garments outside and consider them potentially contaminated and also something that you need to be careful removing.

What part of China are you in?
And don't worry too much, it's a cold. Young, fit people aren't dying from it, it's the already-ill middle aged and elderly.

>>11330574
influenza kills like 1 million people a year, pretty big

>>11330543
Don't be a boomer and don't go outside much.

>>11330578
I think they made this virus to kill off the elderly. China is facing an incoming demographic collapse due to its aging population and low birthrates before its even a rich country. Its poor and yet they've got too many boomers and no young people to take care of them.
I was reading a few news articles about this. China is in the same boat as iran or something. A second world country like most slavic countries that's stuck with western birthrates.

https://www.nytimes.com/2020/01/25/world/asia/china-coronavirus.html

>>11330570
Lmao, this is how people try to predict stocks following trends in /biz/. Then post pink wojaks

>>11330578
>removing mask
Oh yeah, if you're a medical worker then those masks are single use.
Everyone else, you need to consider the outside of the mask contaminated and sterilise it with alcohol spray or something.
The coronavirus can persist on a surface for a week under normal conditions and longer at dry/cold conditions. It does die at 56c/30mins though so you could always steam your mask, it will die even quicker at higher temperatures.
Or keep a bunch of masks and wash them.

>>11330644
Can you wash ffp3 ?

>>11330580
So its basically a normal, yearly occurence and there is no reason for constant threads about it. Got it.

>>11330578
>After returning home
Lol I am not even leaving. I stockpiled food for at least two months. I can't do the same with water so it sucks. Currently in Beijing.
A lot of Chinese people are mentioning SARS and that sounds quite ominous. Some doctorbros said "nigga this shit is nothing", some others said they are legit terrified so I'm not sure what to believe. I got multi-vitamins too. It's not really wasting money because I'll end up consuming all of that food anyway.

Thanks a lot for the tips. Throat went a bit sore today, but it's probably the stomach. I feel fine. Last year we had a flu around here that lasted a month and a bit. I got rid of it in three weeks and lost a lot of weight. Shit was serious and everybody I know around here got it. If this is worse, it's bad.

>>11330824
It's nothing bro, if it was everything terrible they say it is in the media, it wouldn't matter because you would likely die anyway in the chaos. What's it like being a white guy in Beijing tho?

>>11330841
People are really nice and friendly. They have a different way of doing things, some aspects are better and some are worse. Overal feels balanced, a bit like a VIP guy in an alien world sometimes because there's a lot of small cultural things. Chinese medicine is really good at fixing bones or muscular problems, Even if it's based on astrology (I found out recently) it actually cured things I had been dragging for years.
Their vegetables are weird and many, food is not as healthy as I had imagined, often a bit oily. It feels in many ways like the west but with a "fuck safety, move forward" motto. All things considered, it works pretty well... with the occasional crash though.

I'd say long as it remains as it is now it's pretty good. I found many memes about China are actually not true and the smog got surprisingly better these years. It still feels a bit like the comfy bits of the 90 with a cyberpunk vibe. A few days ago I saw a Chinese lady in a traditional dress riding a segway hoverboard while wearing wi-fi earphones and a face mask. You see a lot of old + high tech and new, which creates a really neat aesthetic mix.

>>11330936
You live in a bountiful country.

>>11330361
What I'm worried about is that China isn't telling the truth. Putting cities with millions of people into quarantine seems quite extreme

>>11330981
See
>>11330444

>>11330824
>Lol I am not even leaving. I stockpiled food for at least two months. I can't do the same with water
I wouldn't worry about water, there's no chance that the government will let the water fail, especially in Beijing of all places.
You're just going to have to boil it instead of drinking bottled but that's not that big a deal unless you're worried that the pipes in your building leech metals into it?
Even so, that's usually a long, long term problem.

There's a video doing the rounds on wechat which I tried to download to convert to webm but it wouldn't let me for some reason. You've probably seen this posted to groups already anyway.

It's not really that serious, 2-3% mortality is on par with a bad influenza season. The people dying are nearly all middle-aged with pre-existing conditions or elderly, the youngest was 36 I think. Just stay normally healthy.

>>11330936
>the smog got surprisingly better these years
All your factories and power-plants were moved out of the city, Hebei got a lot worse after Beijing decided to get better.

>>11330981
The reason for the extreme reaction is due to compensate for the fact that it's clear they didn;t learn from SARS at all

>>11330469
>50%
where exactly are people getting this number from?

>>11332474
Anon is fairly clear about how they came to that number and as far as I know, it's accurate for their formula.
The problem is whether it's a fair formula and I'm not sure it is though I acknowledge the problem with calculating death rate using numbers that include new infections that haven't had a chance to kill yet.
Anon's formula has the opposite problem by assuming that early deaths over late "cures" is accurate. Dying is probably quicker than getting to zero virion count.

>>11332493
>Anon is fairly clear about how they came to that number and as far as I know
I've been staying up too late, I completely passed over that last part

>>11330422
Its not a flu variant, I don't get why people keep saying that. And scary flu variants can actually be pretty damn scary. Normal flu kills like hundreds of thousands of people every year. But this wuhan corona virus is almost definitely not going to be a big deal. It’s important that goverments and hospitals take appropriate precautions to minimize deaths, but so far nothing about it makes it seem like anything to really worry about on a large scale.

>>11330578
Not “technically a cold variant” either, like the common cold is generally considered to be rhinoviruses which are in a completely differnt family than Coronaviridae.

>>11330516
That's irrelevant, there was absolutely no treatment for Ebola until the latest outbreak. There's 6 known strains, all with different mortality rates.

GANBARE CORONA-CHAN

>>11330578
Don´t viruses usually mutate to be less deadly? I mean, every time a virus kills someone, it is an unintended consequence of infection, the most successful viral disease is herpes, because it is inoffensive.

the disinformation on pol is beyond laughable
it wasn't even this bad during ebola

The issue is that it's hard to tell how severe it actually is because it's still relatively early and China isn't trustworthy. They say only 1000ish are infected but why quarantine 50 million people? Should have a better idea in a week how serious it is.

>>11332647
Because Ebola was isolate to a single continent

Some of us live surrounded by chinamen despite not living in China, and it is fucking scary.

Imagine unironically basing what you think of this on the official figures from a communist dictatorship. Meanwhile you have 50m people quarantined by armed hazmat soldiers and more videos leaking every day showing hospitals full to bursting point with bodies in the hallways, people dropping dead in the streets and tanker trucks disinfecting entire city blocks.

>its just like SARS bro

You have to be ignorant or closing your eyes to believe this.

>>11332652
Because the number of actual infected is quite a bit larger than what the confirmed cases are. The best way to contain stuff like this is to act soon. It was a rational move by the CCP, if this gets out of control they stand to lose more than anyone else.

>ugh this is nothing /pol/ is so hysterical
>OMG THE TEMPERATURE OF THE EARTH IS UP BY A DEGREE, GOODBYE WORLD

>>11330446
Why? :D

>>11332662
>/sci/s rebuttal to the massive shitstorm that is currently developing to anyone with eyes to see is
>lol its just like a cold bro remember all those other diseases?
>Totally disregards literally everything about the situation other than the figures from the fucking chinese communist party

>>11332661
>if this gets out of control

This disease shows no symptoms yet can be spread for up to two weeks beofe anything shows, this shit is already across the whole of China, its too fucking late. Cunt in seattle wandering around for 4 days coughing onto cunts before he went into the doctors and this is only a fraction of what is going on.

Damn, the panic-mongering around here is astounding.

>>11332683
>50m in armed quarantine
>nothing to see here, don't be alarmed citizen, just a flu variant

>>11332683
Let us have our pseudo-apocalypse for this month, you guys can go back to obsessing over climate change graphs again when we're done.

>>11332687
>>11332691

All I'm seeing is panicked autists extrapolating from very incomplete information. Just calm down and see how the situation develops, its not like you´re doing any position to make decisions.

>>11330361
No, mortality rate is about 3%

>>11332697
>Very incomplete information

It's a whole shitload of information and is certainly more than the

>just believe the communist party guys don't worry

That you retards keep spouting

>>11332683
how new r u?

>/sci/ right now

>>11332724
Yes.

>>11332729
Kek they even admit it

>>11332739
don't even bother this board hates fun

>>11332741
you niggers haven’t been fun for at least 3 years

>>11332741
>Fun

This is the only reason anyone cares about SARS 2.0. They know absolutely nothing will happen and want a little excitement.

>>11332027
Maybe you could link the video to us somehow anon? I would appreciate it

>>11330380
> No man, this one is bad for real.

Yeah it’s going to totally be different from all the diseases that amounted to nothing and disappeared. Totally. It’ll happen this time.
Just you wait.
Haha.

>>11330458
It’s like an Abrahamic religion. They hate the world and the people in it, and can’t wait for it to be destroyed so their fairy tale power fantasy to take place.

>>11332758
Well I don't understand because you climate cultists have been saying the world is going to end for years. So why can't we have fun hoping the world is going to get sick for at least a few weeks.

>>11332644
>the most successful viral disease is herpes, because it is inoffensive.

In an evolutionary sense, the only sense that matters, the less dangerous a virus is, the more successful it will be. An inoffensive pathogen is also much less likely for absolute chad humanity to target with a global Holocaust like smallpox was.

>>11332687
>If I repeat this number enough, maybe it will have significance one day.

>>11332776
>Well I don't understand because you climate cultists have been saying the world is going to end for years

You don’t know who I am or what I think. Don’t pretend to.

>>11332786
I'm speaking to the /sci/ consensus. If you people spoke out against climate change bullshit as much as you did against this, people might take science more seriously in the future.

>>11332790
Hello Cletus

>>11332790
>I'm speaking to the /sci/ consensus

Individuals aren’t the “/sci/ consensus”, nor is the spread of diseases comparable to climactic change

>>11332781
That's why the unknowns scare some experts, because 2019-nCov is at the very beginning of that evolution having just made the species jump, and where we used to have 7 types of corona virus that humans are susceptible to (out of millions) now it's 8. Until detailed study of the current strains there's no way to predict the coming months, probably no reason to panic, but every reason for precaution.

>>11332759
>Maybe you could link the video to us somehow anon?
You got a mega I could upload it to?

>>11332790
>If you people spoke out against climate change bullshit
We speak out against climate change denial all the time. I don't know what you're talking about.

>>11332759
ok, here's one about not touching the outside of your mask.
Audio trimmed obviously but it's Chinese anyway

>why are they quarantining a city of millions of habitants ?
because this is actually the thing to do in case of a deadly unknown virus.
>we can't trust the chinese government !! the figures are at least 10x times worse !!!
The chinese government has literally nothing to gain with retaining information to the rest of the world, as of now there is no reason to believe they are lying
>some random nurse told me there were 90000 infected !!!
unverified video, and even if it was, she was refering to people checking IN to the hospital, which in the case of a quarantined city in china, isn't that far from plausible. Not everyone has the virus if the virus was that infectious you'd see hundred of cases popping up around the world TODAY.
>an anon claiming to be from the UN/CIA/Ukraine/Russia claimed it was a doomsday bioweapon
LARPing, get off /pol/. You can find these kind of posts in every case of a major outbreak.

>>11333079
>Deadly unknown virus
They know exactly what this virus is, its a coronavirus and a variant on the SARS virus.
>The chinese government has nothing to gain
They don't want to face the embarrassment of having this many people infected and possibly having accidentally released a bioweapon onto their population
>Unverified video referring to people checking in at the hospital
She's also a nurse working at the hospital that is most likely getting estimates from other hospitals in the area and getting a general consensus based on that.

Dude seriously, this is way worse than what they're saying it is. If the videos of the bodies lying around in hospitals and doctors saying that tons of their hospitals are filled with people, then I don't know what will convince you.

>>11333129
>hey don't want to face the embarrassment of having this many people infected
you're not making sense, lying about something that will inevitably be found out like this would be even more embarrassing, also :
>possibly having accidentally released a bioweapon onto their population
take your meds
>They know exactly what this virus is, its a coronavirus and a variant on the SARS virus.
It's a new unknown strand of the SARS virus, they don't know how it spreads, what it does, where it comes from, what its infection rate it, don't play dumb with me.
>Unverified video referring to people checking in at the hospital
Still unverified. They don't have the time to test 90 fucking thousand people either way and yes hospital are overrun, its flu season its a massive city, healthcare sucks there and there is still a highly invective virus in the city.

>>11332741
Fun is unscientific.

The animal vector is currently theorized to be Snakes based on Spike Glycoprotein similarities in the viral genome.
https://onlinelibrary.wiley.com/doi/abs/10.1002/jmv.25682

>>11333060
And here's the one I was originally talking about, finally managed to get it downloaded. Not sure why it was giving me so much trouble, the other one was easy.
>>>/wsg/3264224


Again, It was two long for a single 4chan webm so I stuck it on /wsg/ and kept the Chinese audio, it's fairly self explanatory anyway. I'm pretty sure the dude's spray bottle is 75% alcohol which is what's being recommended. Alcohol for cleaning is readily available in China and dirt cheap.

>>11333079
Not that anon but the average Chinese believes that the infection count must be 10-100x worse than anything the government is admitting, they're a pretty cynical people. It is true that there isn't space in hospitals for everyone attempting to check in with anything like a cold so there are people who aren't getting tested and might be infected and some of those are dying.
You'd still expect the mortality rate of unreported cases to match the known ones though so I'd assume 2-3% would hold steady.

>>11333129
>variant on the SARS virus
More like a cousin.

>>11333153
>animal vector is currently theorized to be Snakes
There's some criticism of that paper now, /sci/ is thinking they fucked up.

>>11333141
The CDC said that China wasn't even giving them basic information. They're hiding something.

This thing is definitely some type of Bioweapon. There's a level 4 biohazard facility and virology lab located in Wuhan and according to some reports they were testing a strain of SARS virus there.

>They don't know how it spreads or where it came from.

Its been 10 days, people are wearing full hazmat suits, face masks and studies are being done showing that it potentially has asymptomatic transmission.

>They don't have time to test 90,000 people.

In a country that's not only bigger than the US but has almost 7 times the population, and has way more hospitals? I find that hard to believe, especially in comparing only 90,000 to the over 1 billion people in china.

Multiple videos have also shown nurses breaking down into tears and having panic attacks over the amount of shit they're dealing with. I can guarantee you this would not be the case if it was really the numbers that they're saying it is.

China is pissing their pants over this.

>>11333155
I don't have access to the paper right now but what about their methodology is suspect? From what I gather there's strong evidence that this is a zoonotic viral outbreak but nothing in this genome aligns with known vectors.

>>11333156
China is hiding this because their government is a bureaucratic rube-goldberg machine of blame and shameful display.

This is Chernobyl, not resident-evil.

>>11333060
Thanks for taking the time to do this, its interesting. Let's me picture the situation easier

>>11333155
2 hrs for a webm, i appreciate you anon

>>11333060
Beijingfag here. Yesterday night the delivery guy was coughing. Today I have a sore throat and a bit of a headache, started this morning. That's NOT the thing, is it? Not enough time for incubation and only 63 cases so far here.

>>11333156
>Its been 10 days, people are wearing full hazmat suits, face masks and studies are being done showing that it potentially has asymptomatic transmission.
>people are wearing full hazmat suits, face masks and studies are being done showing that it potentially has asymptomatic transmission.

yes, that exactly what you should do when you're unsure about how a virus spreads. are you in any way retarded ?

>>11333171
I would highly recommend checking yourself into a hospital immediately. Wear a mask and try not to touch or get near anyone else while doing it.

>>11333171
yeah, it usually takes more than a week to have coughing etc, ur fine, is probably the normal cold

>>11332664
White people have proper hygiene.

>>11333173
>Unsure of how a virus spreads

>Multiple studies have already been done showing exactly how it spreads

Might just be you who's retarded I don't know.

>>11333203
Show me those studies then.

>>11333171
It's over. Om the other hand, are there many Chinese cuties out there? Is it simple enough for a white guy with no chinese to get a hot gf (by our standards)

What does /sci/ think about this?
https://twitter.com/DrEricDing/status/1220919589623803905

I don't know man, but a doctor calling this scenario "thermonuclear pandemic" is pretty worrying. Yet you all seem to be downplaying this very much.

Also as a Western Yuropoor what are my odds of being affected? I honestly don't know who or what to believe. Should I be lying back and relaxing or preparing for a quarantine of my own mid-sized city (half a million or so)?

>>11333213
>Out there.
Not these days, no.

>>11333223
If you're city doesn't have a big chinese population, threat level is pretty low. what people forget is that is that chinese cities are different from western cities, they're tightly packed, so spread is easy, not to mention that the memories of SARS has people going to the hospitals over the slightest cough and they end up catching it for real because they're around other people with the virus. That said, the numbers for SARS were probably way worse than the official numbers say, so this new one probably spreads at the same rate

>>11333255
This is so sad, what changed?

>>11333156
>The CDC said that China wasn't even giving them basic information
The WHO said that China is being extremely cooperative.

>>11333159
>what about their methodology is suspect?
I'm not really qualified to say but check the thread for yourself: >>11330532

>>11333170
Thanks anon. I kept having to redo it because it was too large or whatever. When I moved it to /wsg/, it had the wrong audio codec, then it was still too large. At least I know how now, the next big one would be quicker.

>>11333171
>Today I have a sore throat and a bit of a headache, started this morning
Could be but not from your meituan didi, incubation is longer than that. Doesn't mean you didn't get it from somewhere else though.
I wouldn't worry though, the youngest guy to die was 36 and the middle-aged victims nearly all have serious pre-existing illnesses. Healthy people are more or less fine, it's basically a cold that's as bad as a flu.
Still, mask up in case so you don't infect others and keep an eye on it and if you develop a fever, get checked.
I don't know how it is with you but there's a notice on my building's front door with CDC numbers saying that they'll come out 24/7 to check you out if you have a fever. I bet there's something with you.

The fever is the danger sign, until then it's not as bad and you're not dying even if you have it. The duration from fever to renal failure isn't that long though so as soon as you hit the fever stage, call the CDC or go to a hospital that you know is taking people.

>>11333347
>. The duration from fever to renal failure isn't that long though so as soon as you hit the fever stage, call the CDC or go to a hospital that you know is taking people.
That's a good piece of info. So it affects your lungs, intestines and kidney, right?

>>11333347
Not him, but I'm kinda freaking out just a little. If it is like you say it is and the Wuhan virus is just a "cold that's as bad as a flu", then why the massive quarantine and international panic? If it's really that light, wouldn't it be better to just let it run its course instead of freaking out this much? There's also experts who claim it could be 10 times worse than SARS (https://www.dailymail.co.uk/news/article-7920373/Expert-warns-Chinese-coronavirus-outbreak-10-TIMES-worse-SARS.html)) and that the current numbers are like 10 times what China is reporting (https://www.scmp.com/news/china/article/3047319/wuhan-coronavirus-full-blown-community-epidemic-chinese-health).).

The reaction of the Chinese government, and foreign governments to a lesser extent, feels way too severe for something as mild as you're describing. I hope you're right, but it just doesn't add up to me.

>>11333374
We have anti-virals and vaccines for the flu. We don't for this yet.
Also, I'm not certain but although the mortality is maybe lower than influenza, I think it kills a bit quicker.

>>11333367
>lungs, intestines and kidney
Not sure about the intestines, read some papers.

>>11333411
Alright, two more questions:
I mentioned this earlier in the thread, but there's a Harvard graduate doctor (https://twitter.com/DrEricDing/status/1220919589623803905)) who thinks this is a "thermonuclear pandemic" scenario? What are your thoughts on that?

On the other hand, the doctor treating the three cases in France thinks this is "less severe than SARS", your thoughts on that?
https://www.france24.com/en/20200125-new-coronavirus-appears-less-serious-than-sars-says-french-doctor

I'm a complete layman in the field of all the hard sciences, so when doctors start contradicting eachother in such an extreme measure I get a little jittery. One is telling me to sit down and relax, the other is telling me to panic and prepare for the worst.

>>11333429
It's much much worse than what they are telling us.

Why is climate have hysteria left wing but virus hysteria is /pol/?

>>11333429
Scarce information + undocumented virus at early stages of spreading means you should keep washing your hands and wait for professionals to figure it out. If governments are lying as a control measure there's absolutely fuck all you can do about it.

Haha just like the flu bro, don't worry about the 55m in military quarantine and the CCP glassing their economy haha.

>>11333491
>don't worry about the 55m in military quarantine
That's just what you do to prevent a virus outbeak. It doesn't suggest anything about how bad the virus is, only that they don't want it spreading.

>>11333429
Statements by scientists not subject to peer review shouldn’t be given much weight.

>>11333501
>The largest quarantine in human history doesn't tell you anything about how bad it is

Imagine believing this

>>11333156
It's been weeks since this started, retard. Not only that but the World Health Organization said it isn't a big deal right now and said they have reliable information from the country's government
>IT'S A BIOWEAPON!!!!!!
For fucks sake, fuck off already.

>>11333512
Not him, but cities in Sierra Leone were also quarantined during the Ebola crisis. The difference is that we're dealing with bigger, more populated and more closely connected cities while Sierra Leone's cities were smaller and more isolated. It's the largest quarantine in human history because it's in the most populated country in human history. You can't do a "small quarantine" in China (unless it's in the far west in the mountains or something).

>>11333512
Yeah, them just leaving everything to work itself out is apparently what they should have done according to you, because apparently taking any measures at all makes them look bad.

Go back to /pol/ you raving lunatic, repeating the number of quarantined in every thread isn't going to actually make your argument have any more meaning.

>>11333516
>and said they have reliable information from the country's government

Lmao, the same government that is panic deleting mass amounts of social media showing what a massive pack of liars they are.

>Hospitals packed to the walls, bodies lying in the hallways
>People being forced into ambulances at gunpoint
>Doctors and nurses having mental breakdowns because of a lack of beds and supplies

Yeah not a big deal ok

>>11333516
>Two virology labs and one of them being a biohazard level 4 facility located in Wuhan China.

ITS TOTALLY NOT A BIOWEAPON GUYS NOTHING TO SEE HERE!

>>11333535
The problem with a lot of conspiracy theories is that they make the jump from "it's possible" to "this is what happened". A lot of things are possible, yet you don't believe in every "it's possible so it's true" theory. Or do you believe the moonlandings were faked too?

>>11330361
Ebola is deadly but only realistically transmissible through blood, vomit and feces. Ebola is not going to spread in any country with basic hygiene practices. Coronavirus only kills vulnerable people but is transmissible in the same way the flu is.
>>11330482
Lol the same kind you would buy for the flu (Pic related). The ncov-2019 coronavirus probably isn't even in your city. If you're going to be paranoid at least do something cool and build a bunker.

>>11333535
>It’s a bioweapon that’s just a lamer SARS

What a shit weapon.

>>11333540
No I don't believe the moon landing is fake because literally everything about it proves that it wasn't lol.

This shit has some type of coverup written all over it. The reactions, the information that's being given to the CDC, the nurses breaking down, people dead in hospital hallways and yet they're reporting its only 56 people dead?

There's definitely more to this than what they're telling us.

>>11333559
See? You think the moon landings were real because of proof. What proof do you have of your bioweapon meme?
>virology lab
There are virology labs all over the USA. Is yearly influenza now a bio weapon to you?

>>11333583
There was that case of people protesting a dutch virology lab a decade back or something, there is sustained concern despite the lack of incidents.

>>11333583
ok Chang your 48 hour CCPDF shift is over, you get 6 hours sleep before your 48 hour "hospital" building shift starts

>>11333458
/pol/ is pro chaos, they want an apocalyptic plague because it sounds cool

>>11333583
Because the supposed ground zero for this disease, the Hunan food market was only 8.7 miles away from one of these labs. Now they're reporting that the food market probably wasn't the place where it started.

Where else could it have started? Hmmm. Makes you think.

>>11333592
Makes sense for a board that prays to an egyptian god of primordial chaos.

>>11333549
>The ncov-2019 coronavirus probably isn't even in your city
It isn't because in China, hardware stores don't carry dust masks (not that that would help anyway), you go to a pharmacy.

so there are as many recoveries as deaths rn, so since i'm assuming that you die quite fast compared to recovering, this should be looking good soon, right?

>>11333638
It's like the ultimate trial, thanos snap using a virus

https://www.youtube.com/watch?v=8NHO_VeFDhw
I think this interview is very informative, especially the last 10 minutes or so. The long and short of the last 10 minutes is:
>China appears to be at least cooperating more than with SARS, having already allowed us to know the genetic information of the disease
>Even if China is fudging the numbers, for the West this makes very little difference because the disease will still have the same number of entry points (mostly airports) and everybody is already on high alert
>This in contrast to SARS where nobody knew what was happening, people were suddenly dying of this mystery disease and the Chinese were trying to shush everything

>>11333638
The last 10 minutes of the interview also has the doctor mentioning that his biggest concern is lack of equipment in China. That may explain why all deaths we've seen so far are in China (and why the three cases in France are doing "very well"). China lacks the supplies and manpower to deal with things effectively (which may explain the quarantine).

I'm no expert, but I think things are looking relatively good. Especially compared to SARS. As for the estimated deaths in reality being 10 times higher (as some people claim), keep in mind that we could easily claim the same for SARS considering there was less information at the time and (more importantly) the means of testing for the presence of a corona virus were less advanced back then so we probably had more SARS related deaths not directly attributed to SARS.

On an emotional level I'm incredibly scared, but on a rational level I think things won't be too horrible. Though how things develop in the coming week will probably be important.

I wouldn't know how fast death vs recovery is though, so I can't help you on that front.

>>11333725
China is claiming to have effective treatments now, they also think they have a vaccine too.

https://www.express.co.uk/news/world/1233644/coronavirus-china-virus-vaccine-treatment-cure-symptoms

>>11333811
>Express
I'm calling bullshit but I REALLY hope this is true. Last time I checked it would take a year for vaccines to pass trials et cetera. But if this is true... fuck it, it's not even present in my country yet but I'm willing to pay for a shot. Even a few hundred bucks would be a small price to pay for not dying.

>>11333829
Please, don't panic, death is inevitable anyway. I believe panic would cause more damage overall than the virus itself can. Especially with the coverage its getting, every single person case being announced to the public.

>HURR DURR /POL/ SUH RETUHRDED
>EYEM SUPERRER CUZ I BROWSE /SCI/

>>11333811
i also read that Anti viral HIV Drugs are effective


Kaletra 100/25mg

Lopinavir/Ritonavir 100/25mg

>>11330391
kill rate is ~60%

>>11333895
Sauce?

>>11333895
Using what kind of voodoo-magic calculations??

>>11333829
>take a year for vaccines to pass trials
In a civilized country.
This is China.

>>11333895
>>11333898
>>11333901
Not him, but I'm pretty sure he's looking at recoveries vs deaths. There were 56 deaths globally (ie. in China alone), 56 recoveries globally (ie. 49 in China) so he concludes that your odds of surviving are 50/50 (while ignoring that by that same logic, your odds of surviving outside of China are 100%).

>>11332673
This.

>>11333901
>>11333906
>>11333908
They were spreading this same retardation back during the ebola scare and look how that turned out.
>>11330570

>>11333041
Faggot

>>11333940
Ebola wasn't nearly as contagious, get a clue.

>>11333943
They were spreading this same retardation back during the SARS scare and look how that turned out.
>>11330574

Yep TOTALLY normal flu virus! Nothing to see here folks!!!
https://i.4cdn.org/pol/1579968608606.webm

>>11333955
Yeah, it's been known that it can lead to pneumonia since pretty much the start of the coverage.

>>11333955
Wow a random webum of a puking girl. extremely convincing. We're all gonna die.

>>11333955
surely this is just a horror movie clip

>>11333955
Do you think other viruses just stop existing when another bigger one shows up? Corona virus, like the flu and the cold, make it easier to get sick with other ailments, like pneumonia. Pneominia is also in China and a symptom of pneumonia is nausia and vomiting.

Please fuck off back to /pol/ or /v/.

>>11333612
Praise kek

The video of the girl puking is from 2016. She is throwing up activated charcoal which was a treatment after drinking to much alcohol. The video is NOT a girl with coronavirus

>>11334042
People making up shit to cause a scare? Wouldn't surprise me, but source?

>>11333638
>so there are as many recoveries as deaths

How does this chart make sense?

A confirmed case by definition must be a clinical case w/ confirmed coronavirus. That means of all the people who were assessed and met the clinical case definition and determined to have the virus by whatever sequencing method was done either died or 'recovered'. If 56 died it stands to reason the remaining 2008 got better - or are they still in the process of being infected/symptomatic/ quarantined in hospital rooms? What happened to all those confirmed cases who are not 'dead' or 'recovered'?

Source for video of puking girl. NOT coronavirus

https://www.dailystar.co.uk/news/latest-news/woman-vomits-strange-black-liquid-17078242

>>11334053
Fear mongers BTFO.

>>11330657

If the holocaust happened every year would you be ok with it just because it's "normal"?

>>11334051
https://www.nationthailand.com/news/30381027

The person who recovered in Thailand (but now there are 4 of her countrymen joining her) tested negative for the virus two days in a row and was released from the hospital. I'm going to guess that "recovered" means that their bodies fought off the virus and that they're now testing negative and immune. The other cases that are neither dead nor recovered are probably still sick in varying degrees of severity.

From what I know the lethality rate was downgraded from 3% to 2% mostly because a lot of new cases coming in are mild and therefore have better predicted odds of surviving with supportive treatment. Supportive treatment means just letting the patient's body fight the virus and supporting where needed (so if they dehydrate you give them water, if their kidneys fail you hook them up to a dialysis machine et cetera).

I'm going to guess that the three cases in France that are doing "very well" are not yet recovered, but predicted to recover soon. Maybe it's even the case that they show zero symptoms but still test positive.

>>11332776
>climate cultists have been saying the world is going to end for years
that is not the scientific consensus, never has been...
derailing a bit, as a natsoc, isn't the only morally right choice to act on a possible threat of climate change considering the west will be swallowed up by climate refugees? Even if that doesn't happen, there are other risk factors threatening the existance of the white race.

>>11333955
>>11334053
This makes me think of a newspaper article I read earlier today. It was a sort of Q&A article and in it (it's not in English so I don't think a link would benefit anyone) it was brought up that there were videos of nurses and doctors freaking out because of the work pressure, not having enough hospital beds et cetera. The reply pointed out that some (though not all) of these videos are completely unrelated to the current outbreak and from earlier events. I thought that was a pretty weak response but now that I see this shit in action, maybe there's something to it. I'm pretty sure one or two of those videos are truthful, but they're probably inflated by videos of earlier events.

>>11334068
>mostly because a lot of new cases coming in are mild

These are confirmed cases I take it with assays testing positive? I read that some UK based researchers did the mathematics of detected cases and spread and determined the actual case numbers should be a lot higher than what is being told (by China). It wouldn't surprise me - if this virus spreads when a person is in an symptomatic spread with a R0 greater than 1 we should expect the actual rate of carriers (including symptomatic and non-symptomatic) to be higher. I also have issue with the 'case fatality' rate which is being discussed - these by definition must underestimate the total number of people who recover and overestimate the severity of of illness. They do after all rely on a biased figure derived from detected cases after all - those that are diagnosed. All those who carry it irrespective of whether they get ill or not but never get diagnosed will be left out of the equations.

>>11334109
>it was brought up that there were videos of nurses and doctors freaking out because of the work pressure, not having enough hospital beds et cetera.

But we complain about those things even in the UK during flu season (AKA now) every year. I can imagine it's the same in any hospital during seasons where demand is higher than normal (is China in flu season now too?). If so the added burden of a novel virus causing pneumonia and the hysteria being induced in the common population over even the slightest of sniffles or coughs will only compound what are already stressful and testing times.

Some people earlier in this thread were talking about bodies lying in corridors etc. There are two things which must be considered, firstly are they 'fake news' and hype - fake photos pretending to be those of the current situation but really of something else, and secondly that all those 'victims' are not necessarily of the coronavirus pneumonia but people who are already admitted for other illnesses who has had subpar treatment or been overlooked because of the added pressures dealing with the new viral illness. They are victims in a sense - just indirectly but not because they died of the coronavirus in and of itself.

>>11333374
>is just a "cold that's as bad as a flu", then why the massive quarantine
I don't know about you, but I'm fine with not having another cold go around if possible...

>>11334123
Yeah, you're right. I've also seen both claims in various sources: some people claiming that the real numbers must be ten times as high, others claiming that there may be instances where people get the novel corona virus, never report to a hospital (maybe mistaking it for common influenza) and just recover on their own. But especially the latter may be a "positive" miscalculation. Positive in the sense that it means the disease is less severe than is being reported AND that the medical world still takes it seriously because they think it's worse than it actually is.

>>11334137
Yeah, those are solid points too.

>>11333955
that's just an overdose junkie puking

this is real https://www.liveleak.com/view?t=9vf7n_1580007684

Those who have died from this virus already had underlying comorbities. You should only worry if you're old, infant, and/ or have resp disorders. Please remain calm

>>11334053
>daily star

hahahahahaha

>>11334159
>You should only worry if you're old, infant, and/ or have resp disorders.

Basically the same subset of population more susceptible to respiratory illness in general like influenza.

>>11334159
i have muscular dystrophy, will this affect me worse?

>>11333907
depending on the severity of the illness, I'm sure even Europe would cut back on the precautions if necessary...

>>11333955
Desperately trying to find the sauce on this gif. She looks like she drank a coal factory. Black blood?

>>11334163
dec 2016...
Can only be that virus if the source is shitty right?

>>11334188

Johnson and Johnson have already announced they have preliminary research to get a vaccine within a year.

Also, it's great discussing a vaccine but what about information regarding the efficacy of existing anti-virals in treatment? It may be a novel coronavirus but I have not seen much with respect to treatment options - most people that died had significant co-morbidities to begin and we already have proof of recovery in other clinical cases - has some standardisation in treatment been discussed/ implemented yet I wonder?

>>11334179
do you take immunosuppresants?

>>11334203
>Black blood?

Just for your curiosity one of the symptoms of Yellow fever is black vomit.

>>11334215
no, i dont take anything, only some vitamins every now and again

>>11334067
Out of 7 billion people. You would need to kill a million people per day just to make a dent.

>>11334223
You should be fine. I'm guessing you live in a developed country, so i wouldn't worry. The reason why this disease is so rampant in china is because of poor health promotion strategy (i.e. sanitation, hand hygiene, education), poor health infrastructure and being in contact with wild animals. From the evidence I've seen so far, it may not be transferred via aerosol, and you'd have to be in contact with someone who was severely ill with it to catch anything.

Avoid the hyperbole of the media, a lot of these news outlets don't know how to report science.

>>11334244
>From the evidence I've seen so far, it may not be transferred via aerosol, and you'd have to be in contact with someone who was severely ill with it to catch anything.
Source? Because everything I've seen states it can be transmitted through coughing and sneezing (hence the whole "wash your hands, don't touch your face until after washing your hands" thing).

>>11334244
thanks, i was reading that "people with weaker immune systems" were the one's dying, or being hit harder so thx for making me worry less

and yes i'm from Germany :)

>>11334244
>From the evidence I've seen so far, it may not be transferred via aerosol,

>https://www.the-scientist.com/news-opinion/person-to-person-spread-of-novel-coronavirus-confirmed-in-china--66995

Not sure where you are getting your information from but coronaviruses are spread by aerosol and via the respiratory route.

>>11334252
i think if you cough or sneeze water droplets come out which are infecting you. if you wear a mask or cough into a tissue you can't spread it. right?

>>11334258
>if you wear a mask or cough into a tissue you can't spread it. right?

Depends on the type of facemask worn - there are different grades and for different purposes if I recall correctly.

>>11334258
That's what I've heard. It's also what the video here suggests
https://www.youtube.com/watch?v=8NHO_VeFDhw
Already posted this in the thread, but whatever. But don't overestimate the effect of masks, most don't fully cover all sides. The thing masks mostly do is prevent you from touching your nose and mouth with infected hands.

Also you'll need fully closing safety glasses if shit really hits the fan because it can enter through the eyes (or genitals or anus).

>>11334159
is Wuhan atmosphere as polluted as other major cities in China?, maybe this is playing a key role.

>>11334269
>Also you'll need fully closing safety glasses if shit really hits the fan because it can enter through the eyes (or genitals or anus).
if it IS aerosol it's a must?

>>11334280
most likely, can viruses attach to like dust or whatever is in that pollution?

>>11334284
That's what the interview says, but I know nothing of course.

>>11333171
I replied to this post and now I am sick with nCOV 2019

>>11334296

>>11333948
SARS was caught early and proper measures were taken in the first world, that was also nearly 16 years ago. Goodluck enacting those same measures in the current political climate.

>>11334286
I don't see why not
Apparently they survive 24h on a surface

>>11333177
Lol
don't
If 1 out of 200 people waiting there is infected, you're getting infected for sure

>>11332773
Bingo. Replace the "faithful" with neo-Nazi's and "whites" (whatever that changing classification refers to in 2020) of any stripe (that they mistakenly believe are on their side not merely racially, but ideologically too), the "demons/unbelievers/wicked" with colored people, and voila, instant (or eventual) utopia. The /pol/pocalypse in a nutshell.

Is there data somewhere on the number of cases/deaths for each day going back as far as possible? I want to graph the increase.

>>11334335
Don't act like you're so above it loser. Hitler is lucifer and nazis are hellspawns. White guilt is original sin and multiculturalism is the bible. Anti-white rhetoric is way more dogmatic than anything nazis come up with.

>>11330361
It is like all the other disease memes: it's serious, but nowhere close to a world-ending threat.

>>11334338
WHO site. They have reports for 5 days. That closest to «accurate reported» cases numbers you can get to.

https://www.who.int/emergencies/diseases/novel-coronavirus-2019/situation-reports/

We have been over this so many times. From a purely biological standpoint the nCov is pretty tame compared to other shit. The mortality rate and reproductive rate is much lower than most of the other stuff we had to deal with in the past.

The only thing that is new is that China is actually trying to do some proper disease control this time. Some of their methods appear very harsh, such as quarantining the entire city of Wuhan, which is probably not even helping from a biological point of view, because the infection has already spread. Nevertheless everyone is losing their shit.

>>11334385
Yeah, remember this started in december already and they know it remains asymptomatic while actually infecting people. Gooks must know this, hence harsh measures.

But at the end of the day its still a coronavirus so my worst prediction is maybe 10,000 dead at most. AND THATS STILL A FUCKING LOT if it is even going to be that much. With their population density and shit like those wet markets they know they need to be super careful.

Why are you guys worried? Don't tell me any of you cucks actually want to live!

>>11334411
you should add and asterisk to that 10,000 that says "99% in china"

>>11330361
It's highly infective but not that dangerous symptoms wise. It's actually pretty interesting to watch unfold since we haven't seen a fast spreading virus in awhile. I've been taking notes all week because of it.

>>11334067
>if 6 million jews were killed every year, would you be okay with it?
Uh, yes? Duh.

>>11334423
I thought it goes without saying, but honestly, I dont think its even going to be that much

>>11333829
>I REALLY hope this is true
Why?
>the rest of the post
Damn I really hope you're baiting.

>>11333171
Incubation lasts up to 4 -14 days so probably just a normal cold. If you're that worried go ahead and check in at a hospital and make sure you wear a mask and gloves.

>>11334280
>is Wuhan atmosphere as polluted as other major cities in China?

It wouldn't be unexpected if that were the case - in fact I'd take it as a matter of fact that all major cities in China do have bad smog and air pollution issues rather than giving the benefit of the doubt.

>>11334411
>10,000 dead at most. AND THATS STILL A FUCKING LOT

Compared to say RSV? Influenza? Measles?

You need to get some perspective because if you think that's a lot or anything extreme you only display your ignorance.

>>11334480
>If you're that worried go ahead and check in at a hospital

That's bad advice. Hospitals are already overcrowded and understaffed with everyone with the slightest headache, cough, or runny nose clogging the wards. If anything, by going you are probably more likely to expose yourself to someone who does have it than otherwise.

It's better to pay heed to common sense and treat it as a standard cold that you may be experiencing than automatically jumping to the conclusion you must have this new infectious agent.

There is a well known saying in the medical profession: ''When you hear hooves think horses, not zebras'' and people seem to forget that they can just as (if not rather more likely) attribute their symptoms to the common cold, other viral aetiologies etc.

Another day that /sci/ is wrong, let's see how long this board stays in denial.

When main reasons to panic are random posts from random people, memes and mainstream media it means there is no reason to panic at all.

>>11334569
nice random, unsourced data

>>11334569
/sci/ is a board of bootlicking pesudo-intellectual redditors. They're all about skepticism except when it comes to climate change hysteria because it's politically unpopular to do so at the present time.

>>11334569
Going to save this so I can rub it in your face the next time a scary unstoppable doom virus kills us all.
>>11330543

>>11332535
Pretty much this, and it comes at just the exact perfect right time for the CCP so all of China is panicking about a virus instead of having time to think about the fact the CCP just effectively lost the first election held within its supposed borders by literally 90% of votes, and is about to lose another even more crucial one in a few months time.

>>11332027
>Just stay normally healthy.
Easy for healthy people to say if you don't have a heart condition that precludes you from anti-inflammatory drugs should you catch pneumonia from this.

I just had my first blackout ever at the start of this year from a flu too, just don't remember falling and woke up out of breath on the floor feeling like death and with bruises on my knees, guess I should feel lucky I didn't bang my head.

Of course I know (or strongly suspect) it's just a scare to divert (Chinese) people's attentions away from HK, but that doesn't make the virus or its pneumonia any less real, fuck whoever made this in a lab, or alternatively fuck whoever thought wild animal markets to speed up (wildlife) extinction are a good idea.

>>11334569
You know that even if this asspull data is real it mans this virus has no chance causing pandemic? My fucking god, /sci/ is so fucking bad because people like you.

>>11334067
Is this a trick question?

>>11334179
>muscular dystrophy
I wouldn't think that would be a thing for infection but that would make you more vulnerable to general weakness wouldn't it?
I don't think that pneumonia and muscular dystrophy would be good together.

>>11334280
>is Wuhan atmosphere as polluted as other major cities in China?
Yes, arguably a bit worse in fact, it's an industrial city and transport hub, lots of trucks, lots of factories and it's a megacity. It does get good wind since it's on the Yangtze but every time I've been there the air was pretty bad.
But pollution won't be "playing a key role", people cough droplets anyway. Pollution particles adhering to the droplets would make them easier to filter, not harder.
Where pollution would make a difference is in worsening pheumonia because lungs are already under stress and because pollution has known effects on the immune system (probably because its busy reacting to nanoparticles already).

>>11333171
>Yesterday night the delivery guy was coughing. Today I have a sore throat
FWIW: Chinese gov says that the incubation period is 1-14 days...so maybe actually.
How is your temperature? Monitor it and report it to the CDC as soon as you get a fever.

>>11334663
>Easy for healthy people to say if you don't have a heart condition
Then you need to take it more seriously and go full quarantine, or don't be in China.
I wouldn't live in Wuhan if I had a heart condition, I wouldn't live anywhere with bad pollution. There's a few big Chinese cities that reliably have good air.

>Of course I know (or strongly suspect) it's just a scare to divert (Chinese) people's attentions away from HK
Oh...it's retarded.
The Chinese people don't give a shit about HK and never did, the propraganda department did a fine job of painting HK as spoilt children complaining about daddy setting a bedtime for them, not that mainlanders ever needed much of a reason to look down on HK. And putting the country into quarantine is so disastrous to the economy that it would never be done for political purposes since the unemployment and business failures it causes will lead to far worse political problems than it could possibly solve.
The Party is a lot of things but not irrational.

>>11330361
WTF SCI TOLD ME IT WASN'T THAT BAD
WTF IS THIS SHIT
>LINK:

>>11333223
4chan is notorious for downplaying and naysaying everything. It's how immature, middling intellects try to sound smart. Very frustrating to deal with.

>>11335269
yeah, the intellects that support flat earth and similar are much better

reminder that interfering with the movement of people is now racism, and racism is the worst thing in the world

So is it airborne?

>>11335269
>4chan is notorious for downplaying
Is this a joke?

>>11335288
Worse. It might have evolved a bloom phase.

>>11335291
Thinking that 4chan does any one thing consistently is a joke
Or did you get a briefing pack from the leader of anonymous telling you your talking points and explaining how you were held accountable for sticking to them?

>>11335302
what?

>>11335321
I think anon is giving a stupid answer to a stupid question.

>>11335334
I'm stupid for not innately knowing whether a particular virus spreads through inhalation?

>>11335337
Given the amount of discussion on this virus that you literally can't avoid?
Yes. You're stupid if you don't know the most common transmission methods and how to avoid them.
Unbelievably moronic.
Retarded.
Idiotic.

>>11335310
I'm just thinking back to the ebola outbreak where everyone thought it was going to wipe out humanity

>>11335345
This is the first discussion I've looked at.

>>11335346
no they didn't

everyone was concerned it wasn't being handled correctly though

>Cremation centers are overwhemled
i-it's just a flu bro

>>11335302
Fugg

Everyone knows /pol/ is bad for your mental health. I spent all weekend on there because they are right about everything else and I won't be able to concentrate tomorrow with this black feeling that life as we know it is over.

>>11335283
And not even Donard Trumpu wants to be lacist now. He is atoning for his past mistakes.

Ok what are the know and I know case here in the us and what’s the air travel for China to dc and md???

>>11335244
It was nothing. a lemon honey and ginger tisane a day keep the virus at bay. Question is, since I'm an expat, should I GTFO while I can?

>>11335564
>Question is, since I'm an expat, should I GTFO while I can?
Not if you're in Beijing, no. There's low risk and travelling is probably a pain these days and this is likely to blow over.
If you were on the fence about going home for the holidays though then I'd go, classes are cancelled, spring festival is extended and everyone is stuck inside with nothing to do for weeks. Not much reason to stick around if getting home isn't too expensive and you were thinking of going anyway.

Either hit up tantan which must be blowing up these days, or go home and see the folks.

>>11335597
I'll most likely choose to go, then. Thanks
>tantan
wat? You mean the dating app?

>>11335603
>You mean the dating app?
Yeah, I mean what else are you going to do when stuck inside for the next week?
The tantan scene must be blowing up these days. Find one qt who's not coughing and just netflix&chill for a week.

>>11335597
>>11335603
>>11335611
>Just swap bodily fluids during a quarantine bro, what's the worst that could happen?
This is how you get a Typhoid Mary.

I just checked the report on the genome. Looking over the protein sequences that they have isolated, and what strikes me is that there is not a single occurrence of the amino acid selenocysteine (U). Are the any biofags that could determine if there is any significance to this?
t. computer/electronics engineer

>>11335641
Anon is in Beijing, few confirmed cases and you're only swapping with one person (well, unless she's got a cute roommate and your tantan game is really, really good).

>>11335642
Example?

>>11335642
There's a better thread for the hardcore science of it: >>11330038

>>11335642
>not a single occurrence of the amino acid selenocysteine
It appears to just be a rare amino acid in general.

https://en.wikipedia.org/wiki/Selenocysteine
>Although it is found in the three domains of life, it is not universal in all organisms.[8] Unlike other amino acids present in biological proteins, selenocysteine is not coded for directly in the genetic code.[9] Instead, it is encoded in a special way by a UGA codon, which is normally a stop codon. Such a mechanism is called translational recoding[10] and its efficiency depends on the selenoprotein being synthesized and on translation initiation factors.[11] When cells are grown in the absence of selenium, translation of selenoproteins terminates at the UGA codon, resulting in a truncated, nonfunctional enzyme. The UGA codon is made to encode selenocysteine by the presence of a selenocysteine insertion sequence (SECIS) in the mRNA. The SECIS element is defined by characteristic nucleotide sequences and secondary structure base-pairing patterns. In bacteria, the SECIS element is typically located immediately following the UGA codon within the reading frame for the selenoprotein.[12] In Archaea and in eukaryotes, the SECIS element is in the 3 untranslated region (3 UTR) of the mRNA and can direct multiple UGA codons to encode selenocysteine residues.[13]
>Again unlike the other amino acids, no free pool of selenocysteine exists in the cell. Its high reactivity would cause damage to cells.[original research?] Instead, cells store selenium in the less reactive oxidized form, selenocystine, or in methylated form, selenomethionine. Selenocysteine synthesis occurs on a specialized tRNA, which also functions to incorporate it into nascent polypeptides.
Sounds like it's kind of complex to use anyway and viruses are mostly restricted to simple mechanisms since they're hijacking what's already there.

>As of 2016, fifty-four human proteins are known to contain selenocysteine (selenoproteins).
Not a lot.

>>11335642
>>11335665
Also, corona viruses mutate heavily, it's why we haven't wiped them out yet or have a vaccine that lasts more than a year. They're part of the common cold after all.
Given a high rate of mutation, complexity is going to be a problem in reproduction and especially if it's vulnerable. U is encoded for by UGA, which means that a single poly-morphic substitution will cause it to be replaced by something else. Lots of amino acids have many synonymous encodings that all produce the same peptide, this one doesn't. It makes it more vulnerable to be evolved away from and if there's something else that does its job well enough then it won't be conserved. It would only be conserved in the viral protein if it was essential to viral function, which it seems not to be.

>>11330422
They belong to different orders, maybe different phyla. It's like saying a human is a variant of a rat.

>>11334630
>CCP just effectively lost the first election held within its supposed borders by literally 90% of votes
source?

>>11335653
Here is one of the genes lifted from the report.

gene 28274..29533
/gene="N"
CDS 28274..29533
/gene="N"
/note="structural protein"
/codon_start=1
/product="nucleocapsid phosphoprotein"
/protein_id="QHD43423.2"
/translation="MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQG
LPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMK
DLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQ
LPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAA
LALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGR
RGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYT
GAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTV
TLLPAADLDDFSKQLQQSMSSADSTQA"

>>11335695
I think anon is referring to the HK municipal elections though their lack of detail is typical of conspiracy theories where the vagueness of claims makes them impossible to refute and lets them take refuge in even the most tenuously plausible factoid that might match the description given.

But anon doesn't know the political situation in China at all, nobody gave a shit about HK or expected the people there to support The Party. They give a shit about this though and are openly mocking the officials involved which is surely far more damaging to any party loyalty than HK.

pic related is one of the latest examples of how this is inspiring dissent, it's not very clear but these are basically the two top officials in Hubei and somebody else who might be a spokesperson or something.
Everyone in China considers themselves experts in wearing masks now and here's a press conference about the epidemic from the officials who first encountered it.
The governor in the middle isn't wearing a mask, the mayor on the right has his upside down and the guy on the left has his pulled down to expose his nostrils. It's being openly mocked and memed since they aren't taking masks seriously or using them properly.

>>11332659
What bodies dude? Are you referring to that one video where people were sleeping in the hospital halls with covers above their head because of the bright hall lights? Get it fucking together. Learn not to fall for your own dumb assumptions.

>>11332680
Two weeks is max. The average person with the virus shows signs at day 5.

Is this virus redpilling the Chinese? It seems like their trust in the government is much lower than usual.

>Two days ago, at night, the delivery guy was coughing when he brought me my stuff
>Sore throat yesterday
>Getting da sweats today
>MFW only 30 cases here
God fucking damnit.

>>11335779
>It seems like their trust in the government is much lower than usual
It's never that high but yeah, they're more cynical than usual.
It won't last though, the government's quarantine is slowing new infections, they have treatments that are reported as working. Once its over, nobody will worry that much about the state of the press releases. It will even be easy to accept that control of information was necessary to prevent undisciplined responses. A few party officials will be punished for the high-profile fuckups and it will be back to business as usual, possibly with greater support than before.
If it gets loose in India and kills a bunch of people, Xi Jinping's response is going to look positively statesman-like.

>>11330583
I'm waiting to see evidence of elder-cide somewhere, maybe this is it.

I more think it was a fuckup at a germ weapons lab but that's the same thing.

>>11335564
Scratch that. It was NOT nothing. I got sweats (no fever) and headache. Brething is only VERY slightly affected.

talk about a viral meme xD

>>11335819
Sweats without fever is unusual.
Take your temperature often anon. If you don't have a thermometer, just go find a policeman with an IR gun.

>>11335839
should I use an inhaler if I got a virus or will that make it worse long term? Breathing right now is fine BUT... but that may be caused by a lot of things, really. Sore throat is definitely there and I cough slightly once every 30 minutes at most. If it gets worse I'll keep reporting, if it gets better I'll say "eh, it was nothing". It's probably just the regular cold. I am far from Wuhan and not many cases here yet.

>>11335843
Could also be air pollution, the initial symptoms of a cold are the same as air pollution.
Fever is the danger sign.

>>11335846
Been here for years, lungs are doing fine. Or were until recently. It doesn't feel like a lung problem though. More like From throat to bronchi

>>11330570
KEK, saved

>>11330391
>>11330417

Talking about mortality rates when the sample size is so small is retarded.

>>11335854

Plus, China lies.

>>11335858
So does the U.S. gov

>>11335860
>What is every government during every outbreak
Even plague inc with the Olympics got it right.

>>11333156

Should I get some disposable ffp2 masks, or full face masks with exchangeable ffp3 filters? Is that overkill?

>>11330417
Something like 60 dead, 40 recovered, 2000 still sick.
We don't know how long those 2000 have been sick.
Based only on death/survival rate it could be 60% mortality.

It's just a cold bro, don't worry. China routinely shuts down their economic hubs for a minimum 2 weeks.

>>11330361
No one alive during SARS, Ebola, or Zika should even bother reading the news about meme diseases. It’s always nonsense about how the world will end but it never happens. Can’t wait to fucking laugh at everyone when it peters out at a thousand dead or so.

>>11335879
>Something like 60 dead, 40 recovered, 2000 still sick

Not a good metric for determining actual fatality rate. Most of the dead were literal sick boomers.

>>11335858
>Plus, China lies.

China is being open according to WHO.

>>11335895
Haven't you heard?
Anything that doesn't agree with your narrative is fake news.
There are doomers even in this thread that are saying that the WHO is lying and the rumours they made up about flunkies saying otherwise must be the real truth.

>>11335891
All I'm saying is the statistics are skewed by all the new sick people who haven't had a chance to die yet.

>>11335905
They both lie to not spread panic. Nobody's going to completely lock down 10mil+ cities, wear hazmat suits and spray disinfection over a sub flu dangerous virus. It's very possibly African swine fever. Not swine flu, swine fever, basically pig version of smallpox. It kills 100%

>>11334203
Excessive alcohol consumption is treated with activated charcoal.

>>11335910
>It kills 100%
>57 cured

>>11335910
>They both lie to not spread panic

Prove it. Seems like all of the panic is from ignorant laypeople.

> Nobody's going to completely lock down 10mil+ cities, wear hazmat suits and spray disinfection over a sub flu dangerous virus.

It’s more dangerous than the normal flu. Once we develop immunity to it, it’ll go extinct just like SARS did.

>>11335914
>Excessive alcohol consumption is treated with activated charcoal
Also blood in the stomach turns black doesn't it?
Bleeding in the stomach is associated with alcohol poisoning.

One or the other, it's alcohol poisoning most likely.

>>11335915
>>11335916
It isn't coronavirus. Or maybe there is a coronavirus, but who the fuck cares. People are dying of the swine fever. It's a Black Death tier epidemic.>>11333955

>>11335885
AFAIK they DO shut down many services on the new years for like 2 weeks

>>11334203
She's drunk, vomiting Black Vodka. Vile stuff.

>>11330380
As infectious as influenza which is pretty goddamn dangerous. It's not like ebola which is spread only through bodily fluids.

>>11335885
But they fucking do. For holidays.

>>11333079
>The chinese government has literally nothing to gain with retaining information to the rest of the world
China breathes lies. They were attempting to arrest reporters in the first few days of the outbreak, and are now downplaying it throughout social media. On the one side we have random twitter plants saying that this is nothing worse than the common cold, on the other we can see firsthand testimonies from doctors and bodies lining the hospital.
>if the virus was that infectious you'd see hundred of cases popping up
The virus can spread before showing symptoms, and the incubation period is roughly 1-14 days.

>>11335885
>this is the person screeching about bioweapons and conspiracy theories on /sci/

>>11335910
>Nobody's going to completely lock down 10mil+ cities, wear hazmat suits and spray disinfection over a sub flu dangerous virus
They would if you knew anything about public health and population density being a major factor for the ease of a new viral spread. East Asia is not like America or Europe.

>>11335993
How did the reporters even know? You won't notice somebody with a cold as something unusual or worth reporting.
>>11336063
If it didn't spread in Wuhan in more than a month, it won't spread anywhere. I don't see what would make china different. Population density (even if China's was unusially high, which it isn't) only makes the viruses spread faster, it doesn't make them more deadly.

>>11336081
>How did the reporters even know?
That's a good question but the incident is fairly well known and is even discussed openly in China.
Eight people who were talking about it on wechat etc were given a stern talking to and told to shut up, which they did obviously. I haven't heard any credible source saying they were arrested and Chinese media that mentioned it said they "were summoned".
Then the HK journalists documenting the initial investigation at the fish market were made to delete their photos etc before being sent packing.

I would assume that after some whole families came down with illnesses, people panicked and said it was SARS again, that seems plausible. Then the cops said no it isn't.
The real scandal is that this happened a few weeks before some mass gatherings that were basically media stunts (largest banquet record, that sort of thing) which should have been cancelled. I saw a joke about naming the virus after the governor of Hubei or the Mayor of Wuhan.
Anyway, there was definitely noise being made about it in mid December but it was hushed up.
Funnily enough, this all came shortly after an actual plague. There was an outbreak a few months earlier of bubonic plague which pops up now and then because it's endemic in some wild animal populations.

>>11330391
I was amazed to find out that Swine Flu was estimated to have infected 20% of the planet's population. If it had a higher mortality rate we would have been truly fucked. Still killed almost 200,000 people though.

>>11336125
Pigs are haram. Islam wins.

>>11333079
the chinese government stands to gain civil order from lying. their regime depends on people believing they are safe

>>11334737

>>11334737
.

>>11333908
based corona chan only kills yellow people

>>11336165
>>11336166
d-delet this

We already know it will be worse than SARS. It may not have the same mortality rate (we don't know yet), but we definitely know it's spreading much more quickly (R0 of 3-5 wtf!!!), and unlike SARS people are infectious even before they have any symptoms. That is HUGE, compounded with the fact that China was late to start containment procedures, compounded with all the Lunar New Year travel, etc...

SARS caused 8000 cases over TWO YEARS with a mortality rate of 9.6%. nCov is now at 3000 cases in less than a month. High mortality rate actually hinders a virus' ability to spread. What's worse, 10k infections with 9.6% deaths, or 1 million infections with 4% deaths?

And that is assuming that the mortality rate is only 4%, which is impossible to know at this early stage.

Also, note that for the similar coronaviruses SARS and MERS, there was NEVER any vaccine able to be developed. I don't expect any vaccine to be able to be developed for this either.

>>11335885
>China has experienced SARS and been heavily criticized for both their secrecy and their inaction (basically waiting until it goes away)
>SARS was highly lethal, killing 10% of the population
>Wuhan is not only a massive city, but one highly interconnected with the rest of China and beyond through railways and airports
>10% of 50 million (the Hubei population) is 5 million dead, 3% (the current estimated fatality) of 50 million is still 1.5 million dead
>A quarantine would prevent (or at least slow down) the spread while allowing those infected to either recover or die
>As would shutting down events where millions of people from across China gather in a single place
The actions of the Chinese government make perfect sense in the context of the official narrative, even if we presume some numbers are fudged (and they likely are, either deliberately or by information being difficult to assess. Remember that the WHO admitted that the real numbers concerning the Ebola crisis in West-Africa are most likely much higher than the reported numbers). You don't need to jump to conspiracy theories in order to explain the facts.

>>11335879
>>11335891
That and we've had zero fatalities outside of China but multiple recoveries. This, combined with all the videos of nurses/doctors freaking out, the fucking navy deploying doctors and China's plan to build two hospitals in 10 days makes me believe China's biggest problem right now is a lack of means to treat a rapidly spreading disease. Meanwhile other countries have a more steady flow (due to all cases having been arrivals from Wuhan) and are therefore better able to offer everyone the supportive care they need. Again, it makes sense in the context of the official narrative.

If you want to present an alternative narrative as not just a possibility but the truth, you need to show premises that the official narrative can't explain. Otherwise you're asserting it without proof and it can be dismissed without proof.

>>11336495
You mean well anon but you're arguing with a conspiracist, it's like wrestling with a pig.

>>11336495
wouldn't being an in airplane with an infected individual increase the likelihood of everyone on board getting infected?

>>11336682
I guess my answer would be "yes but also no". While it's true that patients in the incubation period are still contagious, they are less contagious for a very simple reason: the disease spreads through the respiratory system. When you start showing symptoms you start having a runny nose, coughing, sneezing et cetera. Generally speaking asymptomatic people do that far less. So technically, even if you sat next to a man with the Wuhan virus and he didn't cough or sneeze, your odds of catching it are very low. Let alone if you sat on the other side of the plane.

But I do agree that Western governments appear a bit nonchalant. If it were up to me I'd cancel all future flights to and from China, while quarantining everyone on every flight from China that came in recently for at least 14 days. But hey, I'm neither a politician nor a virologist.

>>11336696
I always thought breathing the near an infected person was enough if the virus is airborne

>>11332773

>>11336495
>SARS was highly lethal, killing 10% of the population

I don't recall over 100 million chinese dying from SARS...

>>11336705
>if the virus is airborne
It's got to get airborne. Merely exhaling doesn't do that enough, coughing and sneezing is what really works.

>breathing
It's somewhat more about the eyes actually. They're open holes into your body with lots of mucous membrane and every droplet in the vapour clouds you walk through is like a bug on a wind-shield.

>>11336943
>It's got to get airborne. Merely exhaling doesn't do that enough, coughing and sneezing is what really works.
I see, so you should be fine just as long as you stay out of crowds?