[ 3 / biz / cgl / ck / diy / fa / ic / jp / lit / sci / vr / vt ] [ index / top / reports ] [ become a patron ] [ status ]

/jp/ - Otaku Culture


View post   

File: 734 KB, 981x1100, 1443105051966.png [View same] [iqdb] [saucenao] [google]
14138682 No.14138682 [Reply] [Original]

What came first, the Jubjub or the egg?

Monster Girl Pastebin: http://pastebin.com/UevqvF4h

Monster Girl Wordpress: https://monstergirlscollection.wordpress.com/

>> No.14138685
File: 725 KB, 567x800, purest love.png [View same] [iqdb] [saucenao] [google]
14138685

First for purest love.

>> No.14138686
File: 511 KB, 1056x1100, 1442402443602.jpg [View same] [iqdb] [saucenao] [google]
14138686

>>14138682
As far as the encyclopedia is concerned, the JubJub came first.
Checkmate atheists.

>> No.14138687

>>14138674
Scylla. Poor gal is always out-shined by Krakens.

Have some love for the small ones

>> No.14138688

>>14138682
Why would you put such a shit girl on the OP?

>> No.14138690

>>14138682
>What came first, the Jubjub or the egg?
The dick.

>> No.14138691

Didn't take long for the last one to get archived once it hit page 10.

>> No.14138693
File: 363 KB, 600x900, 10krakenclothed_by_snibako-d96szgp.jpg [View same] [iqdb] [saucenao] [google]
14138693

Reposting

http://strawpoll.me/5574408

I'm letting the thread vote for a Monster Girl they want me to commission art for. I'll get it for whoever the lead girl is by the end of Saturday Night.

Good luck, hope the girl you want wins!

>> No.14138694
File: 48 KB, 596x605, ss+(2015-09-25+at+10.32.27).jpg [View same] [iqdb] [saucenao] [google]
14138694

The best part of waking up is tiny mofucore in your cup

>> No.14138696
File: 268 KB, 463x900, ee48fc6c4cd53e9b1133e4cdac88b32b.jpg [View same] [iqdb] [saucenao] [google]
14138696

Mice daughterus are for _________.

>> No.14138698
File: 246 KB, 600x800, 1422381848555.jpg [View same] [iqdb] [saucenao] [google]
14138698

>>14138696
Play hunting.

>> No.14138701

>>14138694
Cute.

>> No.14138703

>>14138698
Oh good, more ideas for a certain story.

>> No.14138704

>>14138693
I'm indifferent to the the way Snibako draws faces, but those are some nicely shaped tits.

>> No.14138705

>>14138693
Scylla is one of the oldest in the bunch and has literally no fan art. Not even a for-fun sketch. Please understandu.

>> No.14138707

>>14138694
Gross.

>> No.14138710

>>14138693
i love bishop, i hope she gets it

>> No.14138712

>>14138694
Waiter, this bit of fuzz in my coffee is attacking me. Can I keep it?

>> No.14138713
File: 332 KB, 1000x1000, 1390121008347.jpg [View same] [iqdb] [saucenao] [google]
14138713

>>14138694
what the fuck is this imitation mofu?
here have some of the good shit

>> No.14138715

>>14138694
Cute, I would let her suck my tongue.

>> No.14138716

>>14138694
>Fitting that proportionally massive finger in her tail
Not sure how I should take that

>> No.14138721

>>14138694
Adorable

>> No.14138722
File: 215 KB, 850x1062, tasty.jpg [View same] [iqdb] [saucenao] [google]
14138722

Yee

>> No.14138723

>>14138694
I want to stomp on it.

>> No.14138724

>You will never fuck a Dragon while she's in flight

>> No.14138725

>>14138694
That's fucking disgusting why is that shit in your cup?

>> No.14138726

>>14138694
>mofu
>manticore
that's wrong though

>> No.14138727

>>14138694
Sounds like a good way to start the day.

>> No.14138730
File: 251 KB, 891x1200, 1422377713702.jpg [View same] [iqdb] [saucenao] [google]
14138730

I want to brush that hair.

>> No.14138732

>>14138724
Mid-air copulation sounds enthralling.

>> No.14138733

So once it hatches it doesn't turn in an actual Jubjub?

>> No.14138734

>>14138724
I'd hope not, there's this thing called gravity.

>> No.14138735

>>14138712
She's skittish, hence feeling you out with her tail. Once she's adjusted to you, and if she decides you won't harm her, she'll give you a more thorough inspection, fluttering about you, crawling up and down, 'sniffing' with her tail.

>> No.14138736
File: 432 KB, 700x990, 1392073876611.jpg [View same] [iqdb] [saucenao] [google]
14138736

>>14138724
Of course not because I want to live! She orgasms we both go down. Difference is I'm not covered in magic armor scales.

>> No.14138738
File: 154 KB, 1280x840, 23725716.jpg [View same] [iqdb] [saucenao] [google]
14138738

>>14138693

>> No.14138740

>>14138733
It dosent hatch they are literally so hungry for cock they can stop their own birth.

>> No.14138741

>>14138733
IIRC, no. It hatches prematurely if a man comes near and essentially becomes a slime. Though I'm not sure if the eggs it lays can become jubjubs or not.

>> No.14138743
File: 272 KB, 800x950, fda1f1cf54a8f5b562a5e0435d47e98d.jpg [View same] [iqdb] [saucenao] [google]
14138743

>You will never have a slightly yandere kikimora keep you on edge as she carries around hedge clippers even if you don't own any sort of garden while she insists it's for the day she makes you a wonderful master with your own house and her lovingly tending your new garden
She will never trick you and then cut your tendons with the bolt cutters because she doesn't want to get the hedge clippers dirty

>> No.14138744

Reminder that Liches are the best girls.

>> No.14138747

>>14138682
Get back into your shell and don't come out anything less than a retarded pink boob bird.

>> No.14138748
File: 465 KB, 768x1024, Scylla_charybdis.jpg [View same] [iqdb] [saucenao] [google]
14138748

>>14138705
I'd like story about a charybdis and her moocher best friend scylla. I always thought the relationship between the two was funny.

>> No.14138750

>>14138743
please stop

>> No.14138751

>>14138743
You have no sense of scale.

>> No.14138752
File: 58 KB, 450x273, 1443064828283.png [View same] [iqdb] [saucenao] [google]
14138752

>>14138744
Definitely my favorite undead.

Also, for anyone who didn't wait around 2 hours for me to write this last night: http://pastebin.com/PwgdreTD

>> No.14138753

>>14138743

If that's slightly yandere then I don't want to know what full on 100% yandere would be like.

>> No.14138754

>>14138743
Monster girls are shit.

>> No.14138755

>>14138748
The fact that a Scylla can save you from a flat-chested gang-bang just makes her all the sweeter.

>> No.14138756
File: 255 KB, 566x1213, 1442184448947.jpg [View same] [iqdb] [saucenao] [google]
14138756

>>14138751
I have no sense of pacing.

>>14138750
Never.

>> No.14138757

>>14138748
>I always thought the relationship between the two was funny.
The Scyllas nab the Charybdis' husbands.

>> No.14138766

>>14138754
Then why are you here?

>> No.14138770 [SPOILER] 
File: 53 KB, 441x424, 1443155707400.png [View same] [iqdb] [saucenao] [google]
14138770

I lack sleep and dont know why im here send help

>> No.14138771

>>14138743
That is not slightly yandere.

>> No.14138774

>>14138770
Jump in the Snake Pit

>> No.14138776

>>14138757
They aren't husbands yet though just random guys the charybdis tried to get, so it's more of clam jamming instead of ntr.

>> No.14138778
File: 491 KB, 971x1359, 1441972666529.jpg [View same] [iqdb] [saucenao] [google]
14138778

>>14138770
Just start counting weresheep.

>> No.14138781

>>14138741
>Though I'm not sure if the eggs it lays can become jubjubs or not.
It can
>Instead, they are the rare Slimes that lay eggs. Jubjubs are born from the eggs, but there is a higher probability that they will become “humpty eggs” than eggs laid by Jubjubs.

>> No.14138786

>>14138743
I just want to see how much a Kiki would cum over a full blown filthy neet that she somehow manages to fix up over a couple of years.

>> No.14138787
File: 482 KB, 808x1000, 1437191915852.png [View same] [iqdb] [saucenao] [google]
14138787

Speaking of NTR, google "cuck king". Trust me.

>> No.14138789

>>14138774
>>14138778
CAn i Count Weresheep inside the snake pit, then can we all cuddle later on?

>> No.14138790

>>14138787
I don't feel like I should.

>> No.14138791

>>14138787
AHAHAHAHA.
Don't mention NTR and use an image of my waifu in the same sentence. NTR is too shit for that.

>> No.14138794
File: 185 KB, 600x425, 9f45f2dc1b5324b87253220ddd2f4ddc.jpg [View same] [iqdb] [saucenao] [google]
14138794

>>14138786
Do you think some would make a childhood game out of it? A group of Kikis hanging out all together comparing how much greater they made someone?

>> No.14138797

>>14138794
The Kiki Goddess is the one who managed to make Chris Chan turn his life around.

>> No.14138800

>>14138790
Just google it, trust me.

>> No.14138805

>>14138800
I still don't trust you.
But that was hilarious.

>> No.14138807 [SPOILER] 
File: 1.96 MB, 500x282, 1443156333668.gif [View same] [iqdb] [saucenao] [google]
14138807

I wish i could cyddle with a snake. i dont care im spelling wrong, too tired
Good Night, May your dreams be blessed with monster girls

>> No.14138810

>>14138787

My sides.

>> No.14138811

>>14138743

Y'see, this is why honest, hardworking Kikis can't find work these days.

All the potential masters are scared shitless.

>> No.14138814

Do dragons lay eggs or give live birth?

>> No.14138815
File: 109 KB, 451x908, Snake Blowjob.png [View same] [iqdb] [saucenao] [google]
14138815

>>14138791
I didn't know anon liked snake blowjobs.

>> No.14138818

>>14138814
Eggs.

>> No.14138820

>>14138752
That was cute.

>> No.14138822
File: 2.10 MB, 1776x2600, 19.jpg [View same] [iqdb] [saucenao] [google]
14138822

I want to work for a Monster Girl Villainess as a slow-witted henchman. Who gets hate-fucked by her everytime her evil plan fails!

>> No.14138825

>>14138815
Those snakes are depraved and lewd.

>> No.14138834

>>14138822
lovely

>> No.14138836

>>14138693
Anon, I'd strongly recommend using a more well-established polling service like PollDaddy. Since it caters primary to corporate customers, it has much better mechanisms against cheating than Strawpoll (which is more just for facebook and random internet stuff).

People tend to cheat with polls a lot more often when stuff is on the line, like story or art.

>> No.14138840

>>14138818

What would dragon eggs taste like? Would they make you big and strong?

>> No.14138846

>>14138840
They make you feel pretty hot and it also feels like you've taken a load off your shoulders.
The dragon has set you aflame and decapitated you.

>> No.14138848

>>14138735
Do they multiply if I feed her after midnight?

>> No.14138852
File: 375 KB, 610x552, 1392614596938.jpg [View same] [iqdb] [saucenao] [google]
14138852

>>14138840
Considering her eggs are probably one of only two things that a dragon values more than gold and may take forever to hatch? Probably like fire. And everything will look & smell like fire to boot.

>> No.14138854

>>14138840
how abhorrent, eating a helpless fetus
i bet you support abortion too, you twisted fuck

>> No.14138858

>>14138693
>Nobody wants a Merrow
Feh.

>> No.14138859

>>14138854
He should go to wonderland, where you can abort a fetus AND fuck it!
What the fuck KC.

>> No.14138860

>>14138852

I meant unfertilized eggs, they're worthless after all. Unless you can just cum on the egg like a salmon.

>> No.14138861

>>14138854
I want to sell the expensive stem cells of aborted MG fetuses for vast profit.

>> No.14138863
File: 26 KB, 300x446, 1348754763834.jpg [View same] [iqdb] [saucenao] [google]
14138863

>"Hey handsome, what can I get for ya?"

>> No.14138864

>>14138863
my shotgun

>> No.14138865

>>14138863
>Do you have Maus burgers here?

>> No.14138867

>>14138840
I bet dragon eggs are a delicacy in the order.

>> No.14138869

>>14138861
that's an excellent idea.
here's the plan:
1. seduce various MGs to have a romp
2. "wear protection"
3. refer them to clinic when they get pregnant, free of charge
4. collect stem cells

>> No.14138872

>>14138787
He's not really THAT bad, is he?

>> No.14138875

>>14138852
So ill just slay the dragon first then eat the egg no big deal.

>> No.14138877

>>14138694
You
I like you
Keep doing these

>> No.14138885

>>14138860
Dragons barely ever lay eggs to begin with. I mean, some reptiles do lay unfertilized eggs, but with dragons I'd assume she'd ensure that it's fertilized.

But in an extreme scenario, I'd imagine she'd probably bury it. See it as a lost daughter or something. Not leave it lying around for a human to steal.

>> No.14138886

>>14138848
They curl up on your chest and purr happily while they nap.

>>14138877
It's .less, you know?

>> No.14138887

>>14138846
>>14138852
>>14138854

I didn't mean eat a random dragons eggs. I meant eating your dragon wifes unfertilized eggs.

That that old comic with the guy and the harpy.

>> No.14138888

>>14138886
>It's .less, you know?
I know.

>> No.14138891
File: 701 KB, 756x1000, 1431729624402.jpg [View same] [iqdb] [saucenao] [google]
14138891

>>14138865
We currently have the 'build-your-own' Maus Burger available.

We let YOU select the ingredients and the maus you're looking for!

>> No.14138892

>>14138694
I like these mofuticores, cute as hell. Good job.

>> No.14138894

>>14138887
I don't think lizards do the lay eggs randomly thing that birds do.

>> No.14138895
File: 47 KB, 378x364, 1344542544131.jpg [View same] [iqdb] [saucenao] [google]
14138895

>>14138886
>It's .less, you know?
Speaking of .less

>>14138694
How are those commissions going? Do you even have any? Have you finished those commissions?

>> No.14138897
File: 155 KB, 600x600, 1437017920032.jpg [View same] [iqdb] [saucenao] [google]
14138897

Busty Werecats aggressively chugging down milk Y/N?

>> No.14138900

If you ever managed to achieve lichdom and found out you couldn't make monstergirls real would you end up spending your eternal unlife shitposting here instead?

http://i.4cdn.org/a/1443130901633.webm

>> No.14138904

>>14138894

But dragons aren't quite lizards.

And I'm betting the transformation would have also accelerated their reproduction cycle to make they more compatible with humans.

>> No.14138908

>>14138894
I looked it up a bit, and some species that don't lay large clutches of eggs may occasionally lay unfertilized eggs, and ones in clutches may end up unfertilized every now and then.

Given MG biology and how hard it's supposed to be for them to reproduce, though, I can't imagine that anything but a harpy might.

>> No.14138910

>>14138900
I'd devote my unlife to creating gynoids / magical constructs in their shape.

>> No.14138911

>>14138895
>>14138892
He's not the one who came up with the idea.
I am.

>> No.14138913

>>14138900
I'd go even further beyond and become a Demilich so I could break reality and make monstergirls a reality anyways

And then I would create Alps and nothing else.

>> No.14138916

>>14138911
Bob?
If so it's already dead in the water since he's such a piece of shit.

>> No.14138918

>>14138682
>Which came first?
The husband.

>> No.14138919

>>14138913
I'll be your Alp assistant who poses naked on the tables meant for work!

>> No.14138921 [DELETED] 
File: 51 KB, 640x640, 225DE94755F75E9C0C17FA.jpg [View same] [iqdb] [saucenao] [google]
14138921

>> No.14138922

>>14138913
So, it's a choice between being a near immortal alp, or a real man that will whither and die unless he becomes a bone lord in your world?
Tough call.

>> No.14138924

is this the hentai forum??

>> No.14138925

>>14138911
Don't care, still cute as fuck. Would pet a tiny fluffball manticore with the tip of my finger.

>> No.14138927

>>14138924
Pretty much.

>> No.14138928

>>14138900
I would work my undead ass off and become god and then once I obtain unlimited power.
I wouldn't make MG real anyway

>> No.14138929

>>14138913
>>>/lgbt/
You can discuss your beloved transgenders as much as you want there

>> No.14138930

>>14138886
my heart

>> No.14138931

>>14138925
I'm glad you feel that way. More to come, at some point.

>> No.14138934

>>14138931
Excellent. the world needs more fluffycore

>> No.14138936

>>14138931
Neat.

>> No.14138937

>>14138919
Anon please, at that point I'm just going to be a floating skull with jewels for teeth. I wouldn't have any patience for those silly antics.

>> No.14138939

Manticores, Anubis', Yetis, and Hellhounds seem unusually popular lately. You know what that means.

Alps in furry costumes

>> No.14138941
File: 17 KB, 200x332, Morte.jpg [View same] [iqdb] [saucenao] [google]
14138941

>>14138937
You bring shame to the best floating skull.

>> No.14138942
File: 139 KB, 596x605, You've angered the wock.png [View same] [iqdb] [saucenao] [google]
14138942

Remember, give all your pets the proper attention they need. You wouldn't want one to become jealous, would you?

>> No.14138943

>>14138939
No, go away

>> No.14138945

>>14138939
Fuck off.

>> No.14138949

>>14138942
People want to send this thread to hell in a handbasket, I guess I'll finally take it.

>> No.14138953

>>14138942
I'LL TAKE 20.

>> No.14138954

>>14138942
Nobody knows what goes on in the mind of a Wock, maybe it's better that way.

>> No.14138957

I want to be a ghost who died a virgin and haunt human/mg couples

>> No.14138958

>Kraken still beating scylla.
Anons, I am disappointed.

>> No.14138961

>>14138958
Not my fault, I voted for sea bishop

>> No.14138962
File: 107 KB, 614x638, 10689157_p0_master1200.jpg [View same] [iqdb] [saucenao] [google]
14138962

>>14138939
Here you go.

>> No.14138968

>>14138957

A ghost girl will fuck you.

>> No.14138973

>>14138958
And I'm disappointed that those two are what are winning. They both have plenty of fanart already.

>> No.14138974
File: 446 KB, 1920x1200, wallpaperher.png [View same] [iqdb] [saucenao] [google]
14138974

>>14138939
Speaking of alps,

I want to see self-insert-tan in a different costume.

bunny suit, maid outfit, nurse outfit.

I would do her in all of it.

>> No.14138976

>>14138942
Wocks are gross.

>> No.14138977

>>14138958
Not my fault, I voted for Nereid.

>> No.14138978

>>14138974
This. I need this.

.less get on it.

>> No.14138980

>>14138939
>>14138962
Silly alps won't fool me

>> No.14138981

>>14138942
Both the Flufficore and >>14138976 will not live to see nightfall.

>> No.14138984
File: 1.01 MB, 1000x1300, 1415231786808.png [View same] [iqdb] [saucenao] [google]
14138984

>>14138958
Scyllas just don't do the whole "Ara ara boya~" thing as well as Krakens.

>> No.14138986

>>14138981
It's already night though, dumb fucking Wocks.

>> No.14138989
File: 500 KB, 700x952, Umm... Why are you sitting here alone. Are you hurt some where. What can I do to help you..jpg [View same] [iqdb] [saucenao] [google]
14138989

>>14138961
brother

>> No.14138990

>>14138981
Because the sun never sets in paradise?

>> No.14138991

>>14138984
Geez lady, will you be careful with that yogurt already? Hold still now, this is my last napkin...

>> No.14138995

>>14138977
mein niger
http://puu dot sh/knm3e/67e49b4496.png

>> No.14138997

>>14138974
I wouldn't mind that. Objectively cuter than Haohi.

>> No.14138999

>>14138968

But it's more fun to haunt people alone.

Ah hell, I'll just pass on then.

>> No.14139000
File: 777 KB, 1576x2000, BREAK THEIR RANKS.jpg [View same] [iqdb] [saucenao] [google]
14139000

>>14138822
>Not working as a henchman and insuring her plans succeed

You don't deserve a nice villain waifu.

>> No.14139002
File: 184 KB, 622x374, 1438211872887.jpg [View same] [iqdb] [saucenao] [google]
14139002

>>14138995
I want to see more design variants of the MGE girls.

>> No.14139015

>>14139002
Variant of holst? Darwin finding differently evolved harpies?

>> No.14139016
File: 172 KB, 736x520, Change...Is gooood.jpg [View same] [iqdb] [saucenao] [google]
14139016

>>14139000
Why work for a villain to enact some overly complicated scheme? I just want mine to be happy & grow strong.

>> No.14139018

>>14139015
Flightless Jubjubs

>> No.14139020

>>14139016
Happy & grow strong?
I like that...
>You Have A Warriors Heart.jpg

>> No.14139021
File: 113 KB, 571x800, katawa monmusu harpy.jpg [View same] [iqdb] [saucenao] [google]
14139021

>>14139018
like this but no wings?

>> No.14139022

>>14138822
I want to be the overambitious right-hand man of a Monster Girl Villainess. I'd Starscream it up so hard.

>> No.14139029

>>14139021
Christ, they aren't gonna be amputees anon.

>> No.14139031

>>14139021
No, ya yutz. Flightless birds don't lose their wings. The wings are just too small for flight. Or alternaitvely, she's too chubby to fly well.

>> No.14139036
File: 70 KB, 800x600, 1984353242343.jpg [View same] [iqdb] [saucenao] [google]
14139036

>>14139015
Kiwi Harpies?

>> No.14139037

>>14139022
So you'd constantly fall flat on your face with each plan and make her life miserable, forcing her to administer angry, disciplinary hate-sex as punishment?

>> No.14139039

>>14139031
Well, the profile does state that the feathers are more for comfort rather than flight. I wouldn't be surprised to see a jubjub who's unable to fly because she's weighed down by her boobs.

>> No.14139040

>>14139036
Will she lay football-sized eggs still?

>> No.14139042
File: 188 KB, 778x1403, Judge Musclecubus presiding.jpg [View same] [iqdb] [saucenao] [google]
14139042

>>14139016
>Why work for a villain with a overly complicated scheme

Because taking over a populated landmass is better than doing nothing.

Kids these days...no sense of proportion.

>> No.14139044

>>14139037

Beast Wars Starscream was the best.

>> No.14139045

>>14139021
Take a Jubjub and make her tits twice as big.

>> No.14139050

>>14139037
Pretty much.

>> No.14139053
File: 1.19 MB, 1440x810, 1436893103819.png [View same] [iqdb] [saucenao] [google]
14139053

>>14139039
I'd imagine that flightless Jubjubs would be like the Land harpies from EMG, except they'd have big titties.

>> No.14139057

>>14139044
Shit, I remember that. Now that I think about it that spider girl was one of my first monstergirl crushes. Well, monster/robot

>> No.14139058

>>14139042
Ruling over a subjugated population is too much effort. All the bureaucracy and logistics of leadership, on top of having to put down uprisings, making public displays of force, and stopping uppity paladins.

I'd much rather help her be the monster who terrorizes the country from the shadows, taking victims without warning and leaving those who survive as jibbering, incoherent messes wracked with terror. It's a lot harder to fight something with no defined goal, and it's a lot more fun to just be able to do things rather than making grandiose schemes.

>> No.14139062
File: 789 KB, 792x1000, 1422174702511.jpg [View same] [iqdb] [saucenao] [google]
14139062

>"BUMBLING FOOLS, THE LOT OF YOU!"
>"Except you of course, Anon.~"

>> No.14139063

>>14139053
I want to adventure with a bald eagle harpy named Glory who is a trigger happy, gun toting pyromaniac.

>> No.14139065

>>14139062
That's one dry ass tail

>> No.14139067

>>14139062
>She doesn't know that you're the one sabotaging her plans to keep her from passing the moral event horizon.

>> No.14139069

>>14139063
She wears sunglasses right?

>> No.14139072

>>14139062
No! She doesn't give you slack for being her husband! If anything, she's even harder on you, using you for 'public discipline'. It sends the message, 'If I'm willing to do this to my husband, just imagine what I'll do to you if you mess up.'

But behind closed doors the super deredere towards you, cuddling and apologizing to you for being so rough & treating the injuries.

>> No.14139073

>>14139062
I like the idea of a bumbling and inept Anon that she just can't help but adore.

>Meanwhile Anon has yet to realize he put his armor on backwards for the fifth time that week.

>> No.14139075

>>14139065
Looks like it's molting time soon. That's always fun, but hearing the other henchmen snigger about hearing me moan throughout the base afterward is horribly embarrassing.

>> No.14139077
File: 146 KB, 393x600, Salamander_0.jpg [View same] [iqdb] [saucenao] [google]
14139077

Is there any salamander stories out there. im new to jp/ so im on a story and art hunt

>> No.14139080

>>14139075
Shedding. Shedding is the word I meant.

>> No.14139083

>>14139069
Of course. And whenever she blows something up an illusion of the American flag appears behind her and if you listen carefully you can hear the star spangled banner playing in the background.

Also stars and stripes print underwear with gold lace.
And a natural bald eagle
if you know what I'm saying

>> No.14139085

>>14139077
Moose's

>> No.14139088

>>14139057
http://i.imgur.com/OuEsk06.jpg

She was pretty great.

>> No.14139089
File: 686 KB, 786x1200, Salamander.png [View same] [iqdb] [saucenao] [google]
14139089

>>14139077
There's one of her naked in a hot spring she made

>> No.14139090

>>14139083
>if you know what I'm saying
Angry FREEDOM loli? That might be cool.

>> No.14139091

>>14139077
Just moose's that I know of, but it's a really long, rambling harem story

>> No.14139100

>>14139062
Oh please. I'm the biggest fool of them all.

>> No.14139101

>>14139091
damn, that thing is door-stopper length.

>> No.14139102

>>14139077
Seafoam had a chapter in his echidna thing.

>> No.14139103

>>14139091
>rambling
Something tells me your memeing and haven't actually read it.

>> No.14139106

>>14139101
I wonder what the word count is up to at this point.

>> No.14139107
File: 800 KB, 1538x2133, seabishop wmc.png [View same] [iqdb] [saucenao] [google]
14139107

>>14138989
Are you the one requesting Sea Bishop on /v/? If so you gotta stop.

>> No.14139109

>>14139106
a wild guess is +300K
dont take my word for it.

>> No.14139115
File: 274 KB, 923x1280, Sea Bishop Whitemage.jpg [View same] [iqdb] [saucenao] [google]
14139115

>>14139107
I'm not?
But hey that's supposed to be white mage

>> No.14139118

>>14139090
What about if she's some kind of ultra cool senpai that the others in the adventuring party look up to?

>> No.14139119

>>14139115
Oh, alright then. Disregard my post.

>> No.14139121

>>14139103
There's no need to be defensive, Anon.
I dropped it in the middle of the wyvern arc.

>> No.14139123

>>14139091
It'd be better if he had an editor. He has a talent for using many words to describe very little. Oh, and the fact that his protag is portrayed as good while doing some very not-nice things. While this could be excused as a narrative/perspective trick, it doesn't work in his over-long harem.

>> No.14139125

>>14139106
Not long enough if he wants to be the world record for "Longest Written Work of Literature in the English Language".

>Chapters: 221
>Words: 4,047,350
>Characters: OC, Lucario, Ness, Jeff
https://www.fanfiction.net/s/4112682/1/The-Subspace-Emissary-s-Worlds-Conquest

>> No.14139127

>>14139118
I was joking about the most reasonable, uh, reason she'd be a "bald" eagle, Anon. Stay with me, here.

Besides, "cool" doesn't really fit for a 2nd amendment screeching pyro. At least not the way the Japs use it.

>> No.14139129

>>14139125
If the world longest work really is a smash bro's fanfic I will fucking cry

>> No.14139132

>>14139125
That's uh. Quite something.

>> No.14139133 [SPOILER] 
File: 34 KB, 341x418, 1443163175566.jpg [View same] [iqdb] [saucenao] [google]
14139133

>>14139090
>>14139118
I was thinking more along the lines of R. Lee Ermey as a tall, slender harpy who is secretly self-conscious about her puffy, bald lower lips and modest bust.

>> No.14139134

>>14139125

What the fuck.

The biggest book I ever picked up was The Three Musketeers, but that pales in comparison.

>> No.14139138
File: 24 KB, 350x359, 1315135345866.jpg [View same] [iqdb] [saucenao] [google]
14139138

>>14139125
>Longest Written Work in the English Language
>Not some 10th century epic
>Not a translated piece from China
>Not a work from a world-famous writer
>Just retardedly long fanfiction from an internet weeb
A part of me died reading this.

>> No.14139139

>>14139129
It is.

>> No.14139141

>>14139123
when you think about it not much goes on does it?

>> No.14139143

>>14139125
Is that all one book? Because even Moose's is technically a series of smaller books instead of one big one.

Regardless, seeing that smashfic is #1 made a part of me die tonight.

>> No.14139144

>>14139138
You'd probably die before you finished reading it.

>> No.14139146

>>14139125
>>14139129
>>14139132
>>14139134
>>14139138
>>14139139
>>14139143
The best part is that it's not even finished. It STILL gets updates.

Imagine years from now, literary historians will have to talk about that in history books for years to come. Let that soak in. You daughteru could be required to do a research report on it for college.

>> No.14139148

>>14139125
At least tell me it's an attempt at a real story and not just 200+ chapters of rambling or gay pokemon smut.

>> No.14139149

>>14139139
well at least the moose saga is something im willing to read

>> No.14139150

Loli Leglock Lilim

>> No.14139152

>>14139123
>It'd be better if he had an editor
That would fix some of the issues but it would be asking a lot given we're talking about amateur monster smut. He needs to be able to edit decently himself, that's what guys like RS do.

>> No.14139153

>>14139150
No.

>> No.14139154

>>14139150
Work her like an onahole

>> No.14139158

4 fucking million words into a ongoing smash fanfic.

where is my yeti? I need my hugs!

>> No.14139159

>>14139146
>daughteru could be required to do a research report on it for college
She better title that report 'The Power of Autism'

>> No.14139160

>>14139091

I like it enough.

I based my own headfiction off of the setting. Same locations, different characters that is.

>> No.14139161

>>14139150
I want to get leg locked by an Oni Pro Wrestler.

IN A CAGE MATCH THIS SUMMER SLAM 2015 TWO ENTER, ONE LEAVES! THEN THE OTHER LEAVES A BIT LATER WITH A BRUISED PELVIS!

>> No.14139165

>>14139146
This is post apocalyptic religions get started I'm sure. Some how it survives whatever shit goes down and due to its status as "THE LONGEST!" becomes venerated and the leading cause of suicide bombings in Civilization 2.0

>> No.14139167

>>14139125
I just. No.

>> No.14139171

>>14139123
>portrayed as good while doing some very not-nice things
>portrayed as good

Do you take for granted what the antagonists have to say are wrong by default?

>> No.14139174

>>14139150
How loli? Just 'smaller than average' loli, or 'You can support her with one hand and see your comparatively huge cock bulging her stomach' loli?

>> No.14139180
File: 590 KB, 600x600, Page 257.png [View same] [iqdb] [saucenao] [google]
14139180

>>14139146
Anon, please.

Time will pass that trash by and it won't even be a footnote in history. At best it will have a singular line of text commenting about it being the longest literature in comparison to some other very long piece of literature that actually has artistic merit or literary importance.

>> No.14139184

>>14139160
I could never get into it. I stuck with it for a while but I always hated the main character.

He always struck me as one of those guys who is a social failure early in life and ends up as a bitter, rotten asshole as an adult, but is blind to his own flaws and blames everything on the world around him. Except as a gary stu. No meme intended.

>> No.14139187

>>14139180
>Time will pass that trash by and it won't even be a footnote in history
You have way too much faith in society. Remember, we're the society that's trying to ban robot sex, praises intentionally shit games on the iphone and adores them, still gives Adam Sandler a job, and thinks you can get PTSD from twitter.

>> No.14139191

>>14139187
>we're the society that's trying to ban robot sex
We aren't all members of the commonwealth, Anon.

>> No.14139193

>>14139187
Keep your dick out of my lawnmowers gears you fiend.

>> No.14139195

>>14139180
Tell me, what is artistic merit?

>> No.14139201

>>14139195
What separates 12 Angry Men from Jack and Jil

>> No.14139202

>>14139150
Sounds great.

>> No.14139212

>>14139201
And now I'm picturing 12 Angry Monster Girls.

>> No.14139220

is Hound still working on that hellhound image he was coloring?

>> No.14139221

>>14139220
That one of the futa hellhound performing autofellatio? That one that made one anon decide to "crash the thread"?

That one?

>> No.14139232

>>14139221
y-yes.

>> No.14139236

>>14139212
>Juror 1 - Anubis
>Juror 2 - Alp
>Juror 3 - Salamander
>Juror 4 - Vampire
>Juror 5 - Oomukade
>Juror 6 - Kakuen
>Juror 7 - Ogre
>Juror 8 - Lizardman
>Juror 9 - Mad Hatter
>Juror 10 - Amazon
>Juror 11 - Titania
>Juror 12 - Giant Ant

>> No.14139255

>>14139165
Bullshit. Lengthy-ass shit like that doesn't get venerated as religious text.

Small things from the before-times that people can cling to do.

Like lemonade packet instructions.

>> No.14139257

>>14139255
Lemonade packet instructions? Why would you need instructions to make lemonade?
Why are they in a packet? Who puts lemons in a packet?

>> No.14139260

>>14139255
Kool aid you generic brand heretic.

>> No.14139266

>>14139257
What, you've never had powdered lemonade?

It's actually pretty tasty.
Real is the best of course, but I prefer powder to concentrate personally.

>tfw no one gets the post-apocalyptic lemonade religion reference
Oh well.

>> No.14139276

>>14139266

I got the reference.

At least I think they did?

Does it involve a train with a jet engine strapped to it?

>> No.14139277

>>14139266
No. I've never had concentrated anything. I've had home-made Lemonade, Home-made Orange juice, home-made Apple juice, the works
Powdered Lemonade? That sounds abysmal

>> No.14139278

>>14139266
I got it, so?

>> No.14139281

>>14139276
>>14139278
Oh. Alright then. Great.

>> No.14139286

>>14139255
My favorite post-apocalyptic religion has these opening lines.
"HELLO RUSTY!"

>> No.14139287
File: 356 KB, 500x700, c972f30a0f3355bf6d5adfc80f94c628.png [View same] [iqdb] [saucenao] [google]
14139287

Since it's a new thread and half a day later, here's a sneaky update reminder for Falling Leaves Chapter 7:

http://pastebin.com/ddcmpLV9

As always, I hope you guys enjoy it. Tell me how much it sucks and I'll make the next installment better.

>> No.14139290

>>14139232
not yet, anon

>> No.14139295

>>14139287
DID THE RAID WIPE?

>> No.14139297

>>14139236
I want to see Salamander tear up and cry about her daughter who ran away from her!

>> No.14139301

>>14139295
Their healers were out of position and their dps was shit, but they got through it by virtue of her being one of their guild's good aggro-tanks and everyone working overtime to keep the healers alive.

Nobody got the drops they wanted and everyone was upset for the rest of the evening.

>> No.14139316

>>14139301
>everyone was upset for the rest of the evening.
This pleases me.
Stay awesome.

>> No.14139321
File: 228 KB, 1200x900, r304.jpg [View same] [iqdb] [saucenao] [google]
14139321

Just wrote over 1000 words about cow tits and I'm just now getting to the actual lewds.

Anyway, goodnight everyone. Snuggle your waifus and keep them safe and warm.

>> No.14139329

>>14139321
I imagine her spine will snap at some point in the next month.

>> No.14139348

>>14139321
>Not leaving your waifu cold, alone, and scared so that they would want your affections more.
Amateur.

>> No.14139371

So I played some of KC's Mario Maker stages.
I hate that airship one.

>> No.14139403

>>14139184
This is my problem with the story too. If Laven were a likable person then I'd continue it, but the guy is actually becoming a bigger piece of shit every volume and yet he's still being made out to be this wonderful guy somehow.
The Gary Stu-ness makes everything worse too, because he'll never get any comeuppance for being an asshole. Even if he can't stu his way out of things, his overpowered harem will do it for him.

>> No.14139440

>>14139403
When is he a piece of shit? When he takes it out on a bunch of human traffickers? When he sacrifices his own well-being for another family's well-being that he hardly knew, but knew they were likely to die if he didn't do anything? Are we reading the same story?

>> No.14139450

>>14139160
>spoiler
>someone else uses a writefag's world in their headcanon
I use a mix of YBA's and Lanternon's. Both settings sound kind of fun but still have their issues.

>> No.14139492

>>14139403
what, is this harem super specail or some thing?

haven't read it yet.

>> No.14139519

>>14139371
Did you get raped?

>> No.14139527

>>14139492
He's the same guy bashing the story in every thread. I don't why he's so mad.

>> No.14139555
File: 51 KB, 176x217, When I see him, I'm gonna beat him with this stick.png [View same] [iqdb] [saucenao] [google]
14139555

>>14139519
There's one where apparently KC just said, "I'm feeling generous with the Bob-ombs today." I'm gonna make an entire level where Bob-ombs just fucking come out everywhere."

>> No.14139562

>>14139527
But its the first time I've posted anything about it.

>> No.14139581

>>14139371
Can you play them on a pirated version? I tried once, went to shit.

>> No.14139611

>>14139555
So I guess KC sucking at world building doesn't just apply to MGE.

>> No.14139630
File: 499 KB, 1585x2035, 1441647058943.jpg [View same] [iqdb] [saucenao] [google]
14139630

>> No.14139639

>>14139630
>>>/furaffinity/

>> No.14139642

>>14139630
Bring out the torches, the furries have arrived.

>> No.14139662

>>14139642
They laughed when I said I'd be a torch salesman in the modern era. But now, all men depend on ME! Fortune shall be made on this eve, and I shall relish in it all! Let the flames of war be spread! ULULULULULULULU!!

>> No.14139683
File: 166 KB, 800x754, 60eb6f5c3b2d71ae3fa3453d8e51d0e6.jpg [View same] [iqdb] [saucenao] [google]
14139683

>>14139581
No, a roommate of mine bought a copy.

>>14139611
As a boss battle, it was kinda neat, but...I'm not sure I can describe it, but I'll give it a try.

>Short airship level where bob-ombs sometimes spawn out of warp pipes, sometimes out of cannons
>Fairly easy getting through this part of the stage
>There's a small part where KC demonstrates that you have to break a breakable block by blowing up a bob-omb next to it
>This is important, because once you go into a warp pipe 5 seconds ahead, there's a large boss room filled with these breakable blocks, with you at the top
>And there are several bob-omb spawning warp pipes with you
>You have to "dig" your way downward through this room filled with breakable blocks by blowing up bob-ombs next to them, using the fire flowers that are purposefully placed in several spots in this room should you fuck up
>Because you're going to want to use them to make space between you and the bob-ombs that keep blowing up
>Then when you make it out, it leads to an area where you have to kill a Big Bob-omb flying around in a clown car
>You then get in said clown car after killing it to hit a switch to turn the blocks impeding your path to a door
I didn't see this door the first time I beat him, because I was too busy collecting the coins around there
So instead, I had to kill myself with no way of getting through.
I left a small comment next to it, saying, "見なかった。。。"
I was so mad.

>> No.14139687

>>14139630
While I like Nayaa's art, I'm gonna be honest, I'd like to see more lamias or Bike Cop's harem as opposed to Polt.

>> No.14139715

>>14139630
I feel conflicted. The mind says no but the dick says yes.

>> No.14139718

>>14138925
brothers, i am learning how to knit with the specific purpose of creating mofucore's

Shits easier then i imagined, but god does it take long

>> No.14139721

>>14139715
>but the dick says yiff.
FTFY

>> No.14139754

>>14139630
Furshit. Still would.

>> No.14139766
File: 424 KB, 720x960, Adorable and Cute.png [View same] [iqdb] [saucenao] [google]
14139766

>>14138836
>>14138693
gonna second this

Also I voted Sea Bishop, the cutest!

>> No.14139780

You are a head of product development and your company has a surefire plan to kickstart the women's monsterization drug market.
What 3 monstergirl types do you want to let women be first?

>> No.14139782

>>14138694
I want to pet it!

>> No.14139789

>>14139780

Echindas.

Echindas by their very nature jump start all other monsters.

>> No.14139791

>>14139780
Succubutt, Harpy, Arachne

>> No.14139792

>>14139780
Shirohebi, Apophis, Echidna.

>> No.14139804

>>14138693
Voted for Nereid but I'm tempted to commission something for her too.

I'm already waiting on two though so many after my wallet recovers. The Muv-Luv kickstarter didn't help.

>> No.14139807
File: 609 KB, 788x1200, Nereid.png [View same] [iqdb] [saucenao] [google]
14139807

>>14139804
Nereid is underrated, she seems like the perfect onee-san type. Even her portrait is relaxed and soft.

>> No.14139813

>>14139807

Wait-

Fin feet and a fin tail?

That's too weird for me.

>> No.14139823

>>14139807
I have a weakness for blue skin and those runes on her skin look really nice.

I bet she has a semi-creepy "fufufu" laugh as she pulls you into the water too.

>> No.14139827

>>14139823
Also I just noticed the rune/tattoo under her breasts looks like it's instructing you to paizuri her.

>> No.14139837

>>14139807
>You will never have a Nereid sister who just spends all day in the bath tub and keeps trying to get her "cute little brother" to join her like old times

>> No.14139839
File: 32 KB, 291x413, Dinner's Ready Anon!.jpg [View same] [iqdb] [saucenao] [google]
14139839

>tfw no Monster Mom.

>> No.14139878
File: 412 KB, 644x503, 1439227466891.png [View same] [iqdb] [saucenao] [google]
14139878

Oink Oink, where the white men at?

>> No.14139892

>>14139878
>Could it be, you're craving my mcnuggies?
What a shit artist.

>> No.14139938
File: 329 KB, 840x1200, 1427330139225.jpg [View same] [iqdb] [saucenao] [google]
14139938

Consensual sex
WITH ELVES!

>> No.14139940

>>14139938
No.

>> No.14139945

>>14139938
You'll make disgusting half-elves!

>> No.14139949
File: 1.42 MB, 1555x1855, AROUND ELVES.png [View same] [iqdb] [saucenao] [google]
14139949

>>14139940
YES

>> No.14139951

>>14139949
NO.

>> No.14139955

>>14139951
Please?

>> No.14139956

>>14139955
No.

>> No.14139998
File: 33 KB, 1200x684, stump.png [View same] [iqdb] [saucenao] [google]
14139998

why are you sill sitting here, anons?

>> No.14140004

>>14139998
Still writing the Bachelor Auction story, finally not sick anymore so I have no reason not to

>> No.14140009

>>14139998
Writing lich things/Waiting for death to take me.

>> No.14140022

>>14139158
I want to run an emergency Yeti/Mindflayer service for trauma and actual, not tumblr PTSD victims

>> No.14140026

Remember when I said this update would come Tuesday and that it would be a full chapter?
That's what you get for trusting an Alp. Still, chapter 13 of Vertex starts here.

http://pastebin.com/chKnJe7D

>> No.14140034

>>14139938
No.

>> No.14140055

>>14135191

"Now's not a good time, maybe later"
>You try to get out from the blanket but she pulls you in closer, her soft breast pressed against your chest
>"Nonny please, you're mine now. I don't need to ask you, but I am because I want you to enjoy it too"
>She's right, you just need to bite the bullet on this one
>"Kaaaren? Karen you awake?"
>Who the hell is that
>Karen lets go and covers your mouth, throwing the blanket over you
>"Yeah, what do you want?"
>"Mom called, she wanted to know if you wanted to see a movie"
>"No, tell her i'm busy today"
>Who the hell is she talking to
>And why does she sleep naked
>"Just go back to your room, i'll talk to her later"
>"Fine, but first who's pants are these. Don't say yours, they are too small for your big ass"
>A stranger has your pants
>"GO BACK TO YOUR ROOM SARAH"
>"Who is Anon Y Mous?"
>Is she looking through your wallet
>Karen gets out of bed and marches to the door, opening it only to slam it shortly after
>You hear something get thrown against the floor
>You poke your head out to see your pants and wallet laying next to the bed
>"Sorry about that Nonny, that was my...my neighbor"
>No it wasn't
>"Who the hell is Nonny?"
>The door opens up, another dragon bursting into the room
>Shorter then Karen, covered in white scales with red hair
>Even when you accept all this crazy bullshit happening to you, it only gets worse

>> No.14140056

>>14140055
Double Dragon?

>> No.14140060

>>14139998
I'll always be here anon, watching you smile, laugh through the good times, the bad. I'll always be here...

[Spoiler]Because I love you[Spoiler}

>> No.14140074

>>14140060
Damn you spirit, haunt me no longer!

>> No.14140083 [SPOILER] 
File: 10 KB, 252x200, 1443182545445.jpg [View same] [iqdb] [saucenao] [google]
14140083

>>14140074
JOIN US!

>> No.14140088

>>14140083
No. I will rule alone.

>> No.14140095
File: 116 KB, 600x484, 1425608528961.jpg [View same] [iqdb] [saucenao] [google]
14140095

>>14139077
>>14139091
There's also Losenis' thing starting from the fourth or fifth chapter, though it's equally long and pretty damn grimdark, and unironically a MGQ fanfic basically

https://www.fanfiction.net/s/9352118/

>>14139125
>There will be a time someone writes something even longer

>> No.14140096
File: 417 KB, 1184x905, 1421296114043.jpg [View same] [iqdb] [saucenao] [google]
14140096

>>14139998
Because I'm avoiding the world.

>> No.14140102

>>14138787
Son of a bitch.

>> No.14140103

>>14140096
The world isn't anything special anyway.

>> No.14140121

Is this the deadening hour?

>> No.14140124

>>14139998
It's fun.

>> No.14140125

>>14140124
>>14140121
Can we talk about how awesome a Manticore family would be again?

>> No.14140131

>>14140125
I don't think it would be. I mean as the male in a pride of what are essentially lions it'd be the good life, but come on. TAILPUSSY STINK.

>> No.14140134

>>14140125
Of course I mean who doesn't love drooling phallic tails and v-ing the fatheru?

>> No.14140135

>>14140026
>no actual laser tag
>no spadetail schlicking
This is not how you bite the bullet.

>> No.14140138

>>14140134
Would you be the fatheru or the adopted human boy?

Both sound good to me.

>> No.14140144

I want a big butt Wolf girl to lay on her tummy and shake her booty every time she sees something odd/suspicious/new!

>> No.14140146

>>14140125
I want an adult Manticore imouto. Around 18-19 so a fair few years younger than me but still an imouto with a brother complex.

>> No.14140148

>>14140146
Well she did say she was going to marry you when she was younger anon, are you ready to say yes?

>> No.14140149

>>14140138
Probably the shounen boya because I like mostergirls to be big, for me at least.

>> No.14140150

>>14140149
I assume a Manticore would be bigger than your average human.

>> No.14140151

>>14140149
Would you be mommy's precious little boy?

>> No.14140153
File: 1.97 MB, 3000x4000, 1403795593892.jpg [View same] [iqdb] [saucenao] [google]
14140153

>>14140148
Well I did humour her and tell her when she grows up and she did grow into a wonderful woman, I'd be a fool to say no.

>> No.14140162
File: 367 KB, 2000x2000, 1437166086731.jpg [View same] [iqdb] [saucenao] [google]
14140162

>>14140151
I'd be very tsun towards my family to hide my obsession with winghugs and the throbbing tailpussies of courshe.

>> No.14140169

>>14140162
Enjoy your vacation

>> No.14140170

>>14140169
They expect me in the wreckage brother.

>> No.14140174
File: 31 KB, 546x317, megahomu-chan-ni-kurosto-hakasetai-22.jpg [View same] [iqdb] [saucenao] [google]
14140174

What ridiculous things would MGs shout during sex?

>> No.14140184

>>14140174
A Lich would shout Hoivin meivin!

>> No.14140189

"Wonderland too cosplay and vanilla? Well fuck you then, take this and shove it up your asses!" - KC publishing humpty egg.

>> No.14140192
File: 45 KB, 500x281, One Track Mind.gif [View same] [iqdb] [saucenao] [google]
14140192

>>14140174
http://imgur.com/rhknDB0.jpg

>> No.14140209

>>14140192
>http://imgur.com/rhknDB0.jpg
Good one.

>> No.14140225

>>14140149

adopted geek with a defiant attitude and an aim to misbehave (until adopted mom or sisters 'calm me down' via forced semen removal)

>> No.14140233

>>14140055
To make it easier, K before dialogue is Karen, S is Sarah.

>S "Karen who the hell is this?"
>K "GET THE HELL OUT"
>She starts throwing pillows at the newest person in the room
>S "Stop i- Dammit Karen stop. Who the hell is he?"
>You lean out of the bed and grab your pants
>K "He's none of your business, now leave or you're moving back in with mom"
>What the hell is going on anymore
>S "Fine, but you're telling me everything later"
>She leaves the room, not before throwing your wallet back at you
>Karen gets out of the bed and starts to get dressed
>You take this as a hint and put your pants on
>There is an awkward silence between the two of you, the only noise is Sarah in another room
>After the two of you get dressed she leads you back out into the kitchen
>'Sarah' is sitting down with her arms crossed
>Must be hard to look intimidating when you're the smallest person in the room
>S "Can I get an explanation now"
>You want one too
>K "Sarah this is Anon, he is my husband. Anon this is Sarah, my sister"
>S "Already engaged? Why didn't you tell me, mom or dad about it?"
>This is getting awkward
>You try to slip away but Karen snatches you by the wrist
>K "I decided we should get married last night."
>S "I can understand that, but why have I never seen him before?"
>K "Well....we just met last night"
>S "You picked up a guy you met at a bachelor auction? How much did he cost?"
>K "Almost $1000"
>She lets out a low whistle
>S "Do you want to tell mom and dad or should I?"
>K "Nonny should, he needs to meet them anyway"
>Son of a bitch

>> No.14140239
File: 66 KB, 1024x576, little brother club.jpg [View same] [iqdb] [saucenao] [google]
14140239

>>14140225
Would you join a gang of human delinquents?

>> No.14140242

>>14140233
It's like I'm reading ren'py code

>> No.14140248

>>14140026

>>came to thread first time in a month to bitch at Alpanon at lack of dark elf smut
>>found next chapter was put up while i was en-route to work

>> No.14140267

>>14140239

>>14140239

only if they were all girls

for the potential of:

when my sister catches us in the aftermath of our delinquent behavior

1) them watching my manticore family 'pacify' me

after they snickers bring her attention to them

2) me watching when my mom / sister decide the girl delinquents are a disruptive influence on me and should be disciplined too

yuri is not evil if it's part of bisexual adventures

>> No.14140276

I need a update on what the current writefags are doing

>> No.14140284

>>14139630
luz needs to learn not to molest Polt, that's my job.

>> No.14140293

>>14140276
thinking if i should write more suffering for the degenerate shirohebi that got kicked out of her house.

>> No.14140299

>>14140293
Ive got a hour of boredom left for me, give me that link!

>> No.14140307

>>14140299
sure i guess
https://archive.moe/jp/thread/14127923/#14127954

not sure how i can make her suffer in the city though. maybe bullies. or maybe i will make her happy, who knows

>> No.14140308

>>14140276
Leg-locked cunnilingus with a Jinko.

>> No.14140314

>>14140242

You're not wrong. It actually compiles without error too.

>> No.14140318

>>14140276
HORSE PUSSY
http://pastebin.com/Ui5kMQDs

>> No.14140320
File: 116 KB, 500x500, 1245511111.png [View same] [iqdb] [saucenao] [google]
14140320

i cant think of any

this is no good

>> No.14140321

>>14140276
Building a parts list from a schematic to fix my amplifier. Then probably doing some prep for my weekend pnp game.

Won't get to do any writing until at least late tonight.

>> No.14140323

I want to give a Yeti, a Yuki and a Wendigo burgers where the patties are made with a dry rub consisting of powder ground from the four hottest peppers on Earth and watch their reactions!
Then apologize with a Neopolitan Milkshake!

>> No.14140325

>>14140320
Chinese dresses or skintight spacesuits.

>> No.14140329

>>14140320
Lich in a lab coat.

>> No.14140333

>>14140276
brainstorming on how to kick off part 2 of my stroy thing.

>> No.14140336

>>14140320
Thunder bird in a diving suit, for no reason

>> No.14140337
File: 82 KB, 620x877, 1436288506291.jpg [View same] [iqdb] [saucenao] [google]
14140337

>>14140242
>>14140314
If it sucks I know, I don't have the creativity I had when I started writing

>> No.14140344

>>14140239
>gang of neesan monstergirls
>they like stories of brothers doing brotherly things
>always on the lookout for boys going off the path and teach them to be manly as only sisters can
>ready to up the shit of anyone who messes with their outouto
>they take turns spending time with you
>marathoning martials movies with the oldest
>the genki and the thug who's afraid of being too manly and secretly likes cute things cook for you and take turns feeding you
>lazing around in bed being cuddled by the big ttitted baka
>getting positively thrashed with the second oldest/lieutenant and carryng her home while she nuzzles you and lets it out she loves your scent
>lap pillow as your oneesan gives you her chastity, cupping your face as you cum because your first O face is for her onlyEach girl gives you their maindenhead, encouraging you feel good and give them your love
>passionate competitive sex with them all, stimulating you all at once
>Your arm being licked and fingers suckled while another uses your hand to masturbate
>Nibbling on your belly and ears, grinding on your legs, trapping you with their bodies, letting you feel their warmth as they guide you to touch their weakspots
>Sniping for kisses, their smiling faces hovering above yours as they look deeply into your eyes and say "Marry me, Marry me
>Too much, TOO MUCH, any more and you'll die from happiness, but you fight though it until every girls has your seed inside her, then promptly pass out
>Wake up under a blanket of sisters all cleaving to you
>You notice a picture nearby and pick it up
>It's all of them surrounding you, one pinching your cheek, another kissing the free one while the rest throw peace signs
>There's lipstick writing on it
>"WE LOVE LITTLE BRO!"

>> No.14140346

>>14140323
>Yeti
Yetis eat everything, she enjoys the burger without complaint
>Yuki
Thinks she's melting, will appreciate the milkshake to cool her mouth
>Wendigo
awawawawawawa

>> No.14140351

>>14140346
>Wendigo has steam coming from her coat as she runs and awawas around

>> No.14140352

>>14140307

>>14140307

story was from brother's PoV

you can make her 'suffer' by having the brother run away to find her.

Than you can make her ?suffer? when she sees other dominant girls drain him dry whenever he is out of her eyesight

Than you can make her suffer when she has to study in MGU and somehow try to protect her kid brother from being used a cum pump by her peers and every other unattached MG he meets - doesn't need to be 'bullies' just other monster girls doing what monster girls do

>> No.14140364

>>14140333
I am a zelda fan and I demand you give me LINK!

>> No.14140368

>>14140352
yeah that's a way i didn't consider. i only thought about just changing to her perspective or get another anon in the city as spectater

>> No.14140371

>>14140364

Wrong thread?

>> No.14140372

>>14140364
http://pastebin.com/5xd3wgza

my issue right now is how do i work in the change?

>> No.14140377
File: 28 KB, 1280x720, [Asenshi] Onee-chan ga Kita! - 09 [B17FE372].mkv_snapshot_02.14_[2014.09.02_23.39.07].jpg [View same] [iqdb] [saucenao] [google]
14140377

>>14140344
The triangle of lewd approval.

>> No.14140386

>>14140344
This has my full approval.

I want a family of Manticore onee-sans.

>> No.14140390
File: 569 KB, 900x900, 5f6d168ef44a592a7010cfa858fe9de6.jpg [View same] [iqdb] [saucenao] [google]
14140390

>>14140344
>you will never have this

>> No.14140391

wait, so a wendigo's husband become a monster that violates her and protects her? does she ever lose the coat or take it off?

>> No.14140401

>>14140391
Coat is like a small pocket dimension apparently, you live inside with her, monsterization is like squiddification, you can change back at any time or not at all. Stands to reason as why mindflayers and wendigo aren't purge on sight.

Scratch that on the mindflayer.

>> No.14140414

>>14140401
Mind flayer is Mge's "getting a smile painter on your soul" problem taken to its logical extreme.

>> No.14140424

>>14140414
I know. I hate it.

>> No.14140435

>>14140424
I dont know about you but I love it,
free will is overrated

>> No.14140439

>>14140414

there are some benign potentials there.

How about a therapist that actually works?

Want to quit smoking? She can code you to mentally despise it. And she charges in volume of semen per visit and difficulty of requested programming.

>> No.14140443

>>14140435
ths tbh

>> No.14140471

>>14140401
>>14140414
Mindflayers are the best "take-you-away-to-my-rape-cave" MG.

With things like Ushi-Onis, Amazons, and Jubjubs there's always that period of absolute suffering before incubization proper sets in. With Mindflayers it's just one *schlorp* and you're already a person who knows nothing but pleasure for the rest of your existence. And that turns me on.

>> No.14140487

post werebats

>> No.14140488

>>14140471

>you're already a person

are you though?

It really depends on how much of 'you' she decides is extraneous to her needs.

Like were you a person who had hobbies before she kidnapped you - might not want a boy-toy who misses those... Had any person attachment to other people? why would she want you to remember anyone but her?

there is of course always the hope that she will like you enough not to destroy you and make any 'adjustments' minimal... but if she isn't and the only thing you are left is a program to love and fuck her, than that's more like getting killed and your body used a fleshy servitor from warhammer setting

>> No.14140489

>>14139998
Why are we still here? Just to suffer?

You feel it too, don't you?

>> No.14140499
File: 155 KB, 1023x629, 1439957322495.jpg [View same] [iqdb] [saucenao] [google]
14140499

>>14140488
Creature, entity, organic dilder, I don't give a hootin' horse's heck. It feels good.

>> No.14140508
File: 337 KB, 861x1109, 1440621786763.png [View same] [iqdb] [saucenao] [google]
14140508

If you come across a young Ushi-Oni in the wild please be sure to keep eye contact at all times when backing away slowly, failure to do so will likely result in hugs and possibly rape.

>> No.14140511

>>14140508
or I could piledriver her

>> No.14140516

>>14140508
post the backpack mini-ushi

>> No.14140520
File: 124 KB, 452x541, 1434494655265.png [View same] [iqdb] [saucenao] [google]
14140520

>>14140516

>> No.14140527

>>14140508
As if a spidercow that size could rape me, hah! I'd like to see one try.

>> No.14140534

>>14140520
: 3

>> No.14140540

>>14140320
Do something with this one >>14138974

>> No.14140548
File: 63 KB, 500x500, 33331111.png [View same] [iqdb] [saucenao] [google]
14140548

http://puu sh/knGUV/042fdacedf.png

still nothing...

>>14140540
>>14140325

ill try..

i still feel like im forgetting something...

>> No.14140557

>>14140548
>forgetting something
The basics of CQC?

>> No.14140559

>>14140548
how about something in a submarine? dont care what, just use it as background practice if you want.

>> No.14140560

>>14140548
>i still feel like im forgetting something
Capitalization? Or monster girls in maid outfits?

>> No.14140562

>>14140548
>http://puu sh/knGUV/042fdacedf.png
Neat. how about some bindings/manacles on the ankles?

>i still feel like im forgetting something...
Clearly, you forgot to draw more cute, tiny manticores.

>> No.14140570

>>14140548
>forgetting something...
Are you pants on head retarded?

>> No.14140573

>>14139878
Yeesh, having a big ass without proportionately thick thighs is not the way to go.

>> No.14140575

>>14140570
Is this a rhetorical question?

>> No.14140576

>>14140233
Why you keep dyin' nigga?

>> No.14140577

>>14140573
what about thick ass and small ass?

>> No.14140580

>>14140575
It isn't quite entirely not.

>> No.14140594
File: 118 KB, 1006x971, 1434638576559.jpg [View same] [iqdb] [saucenao] [google]
14140594

>>14140344
Hnnngh.

>> No.14140598
File: 133 KB, 493x800, Mantis 1.jpg [View same] [iqdb] [saucenao] [google]
14140598

>>14140576
I got sick and it ruined my creative flow, i'm sorry Anon

>> No.14140599

>>14140573
That's because it doesn't occur that way in nature. The glutes connect to the femoral bicep so a big ass will have big thighs unless its a fake ass.

>> No.14140606

>>14140548
Are you just going to draw your shitty OCs or something?

>> No.14140607

>>14140548
How about a monstergirl soldier like from Graystorm or Spider and Fly?

>> No.14140610
File: 532 KB, 711x910, 1442625581322.png [View same] [iqdb] [saucenao] [google]
14140610

>>14140364
???

>> No.14140616

>>14140598
Ah, no problem.

>> No.14140618

>>14140276
Oh, don't worry! The update is coming! And it'll be amazing! With dragon plushies and cute mother/daughter shenanigans!
No really, I am still working on it. Honest. Just have a lot of shifts in a row right now at work and it's draining my energy.

>> No.14140620

I want to lead my Jubjub waifu around in public with a nipple clamp leash!

>> No.14140621

>>14140610
i think he wanted to make a joke about asking for that link to the paste

>> No.14140622
File: 228 KB, 500x996, 3535232552.png [View same] [iqdb] [saucenao] [google]
14140622

>>14140557
no, i still got it

>>14140606
yes.

>>14140607
never read it.

>>14140559
sounds interesting

>> No.14140623

>>14140276
Slowly editing my last story and preparing ideas for my next one.

>> No.14140625

>>14140622
What, you want a request or something

>> No.14140626

>>14140622
>never read it.
The only writefag stuff you read is whatever schlock Bob puts out.

>> No.14140632

I want beast to continue his roulette series.

>> No.14140640

>>14140620
>nipple clamp leash
>not a clit leash
You blew it anon, you blew it.

>> No.14140647

>>14140640
Okay why not both? At the same time!

>> No.14140668

>>14140625
What he wants is attention.

>> No.14140669

>>14140668
That, and he's avatarfagging with his OC 100% of the time.

>> No.14140670

>Shoggoths taste like blueberries
Well alright

>> No.14140674
File: 325 KB, 723x659, 1438183305214.png [View same] [iqdb] [saucenao] [google]
14140674

>>14140670
Huh?

>> No.14140677

>>14140632
I would like art of that wizard guy

>> No.14140683

>>14140670
REMOVE SHOGGOTH remove shoggoth

But first lick her blueberry body

>> No.14140686

kikis are boring! BORING!

>> No.14140689

I want to carry my Jubjub waifu around in a baby harness so she can have me inside of her at all times!

>> No.14140693

>>14140686
I take boring over abominations.

>> No.14140695

>>14140686
Someone hasn't read all of the Kiki stories we have. Kikis are damn interesting anon you pleb.
Even if they're a little boring they're far more interesting than you.

>> No.14140696

>>14140677
why ask for art of the wizard? iif you want art of beast's stuff then what you really should be asking for is art of the ryu and her mother

>> No.14140715

I want to slap an Alp's titties around and see what happens.

>> No.14140718

>>14140715
Kyaa-ing and jiggling tits, I'd presume.

>> No.14140722

>>14140715
>>14140718
Alps are yucky.

>> No.14140728
File: 403 KB, 1300x1489, 6dd593c7c363c3248a7be80557e9ad9d.jpg [View same] [iqdb] [saucenao] [google]
14140728

>>14140715
Why not an actual Succubus instead of some forced meme monster "girl".

>> No.14140730

>>14140715
Grabs your hand in an effort to make you stop, but things get awkward when it leaves your hand resting on her titties and she doesn't try to move your arm away afterward?

>> No.14140734

>>14140696
I would have said the cerberus sisters, but we have enough hellhound art as it is.

even so if i had money for a commission I want that scene where the sisters are scaring the crap out of julie

>> No.14140755

>>14140674
What would I have to do to convince them to have a threesome?

>> No.14140757
File: 882 KB, 1050x875, e159bfafd18d214a98bacdc8fe50d94b.jpg [View same] [iqdb] [saucenao] [google]
14140757

>>14140728
There's even plenty of doujins out there where a regular succubus has a nervous and easily teased personality.

I want to slap around the titties of a succubus who's never been with a guy before and always got told by her over protective father that men are scary.

>> No.14140760

>>14140715
Grats, you're married to her now.

>> No.14140761 [SPOILER] 
File: 833 KB, 1280x720, 1443197969849.png [View same] [iqdb] [saucenao] [google]
14140761

Have you accepted the love of Horse Pussy Kingdom yet?

>> No.14140767

>>14140761
All horsepussy is shit.

>> No.14140768

>>14140728
Because she'd like it and try to rape me.

>> No.14140769

>>14140674
Someone asked KC about their slime jelly after reading the latest profile. It's very difficult to accurately describe the taste of a Shoggoth, but blueberries are the closest to it.

>> No.14140774
File: 316 KB, 800x686, 1418251395921.jpg [View same] [iqdb] [saucenao] [google]
14140774

>>14140761
Is daughteru making mandatory?

>> No.14140777

>>14140761
No. Their pussies are fine but their bodies are weird and bulky and bad for cuddling. Maybe if there was an eternal oppai loli Centaur I'd consider it, but even then she'd still have those annoying hooves and a lower body that isn't soft or squishy. Plus, she's got no butt.

>> No.14140779
File: 3.89 MB, 1842x3024, Horse Pussy.png [View same] [iqdb] [saucenao] [google]
14140779

>>14140761
You'd better believe it.

>> No.14140791

>>14140761
I know I did

>> No.14140793

>>14140734
yeah julie did kinda deserve that.

Putting my 2 pence into this "wanting art of beast's work" thing then I want that lamia, her description was a little unique

>> No.14140794

>>14140761
Nah, that winking thing they do with their clits is really fucking weird and kinda gross.

>> No.14140798

>>14140774
>You'll never give your tiny centaur daughteru piggyback rides

>> No.14140799

>>14140761
You kept insisting until I did.

>> No.14140801

>>14140761
I wouldn't mind being friends with a nice easy going heavyweight.

>> No.14140806

>>14140761
Foals can be cute but the second they get bigger than me I'm out.

>> No.14140807

>>14140798
>You'll never have your tiny centaur daughteru ride your cattle prod.

>> No.14140811
File: 471 KB, 703x1000, 1439569850562.jpg [View same] [iqdb] [saucenao] [google]
14140811

>>14140761

I would a Dairy Breed.

>> No.14140813

>>14140761
My kingdom for a horse pussy!

>> No.14140814

>>14140807
Good.

>> No.14140815

>>14140807
>You'll never do electro play with your tied-up tiny centaur daughteru and an actual cattle prod.
This would be ok.

>> No.14140816

>>14140761
>large, muscular
>gentle, good-natured, absent-minded, dim-witted

I wouldn't mind a piece of that.

>> No.14140820
File: 2.10 MB, 1960x2901, 40637801_p0.jpg [View same] [iqdb] [saucenao] [google]
14140820

>> No.14140822
File: 236 KB, 1920x1076, clearhistory.webm [View same] [iqdb] [saucenao] [google]
14140822

>>14140761
>horse pussy cavalry brigade ends up taking a squad of human men as P.O.Ws
>they strip them of their armor and clothes and put them in chains, forcing them to march back to their camp
>they're actually marching them in a huge circle
>while doing this, they continuously tease them with tail flicks, feel-copping, and sickly sweet flirting
>eventually a man reaches his limit, and collapses to the ground in exhaustion
>they go over to him and let him rest on the back of one of the centaurs, letting him lay his head on her shoulder so he can take in the smell of her hair
>this continues until every male has found a centaur mate of his own

War is hell.

>> No.14140826

I want to sniff glue with a Centaur!

>> No.14140827

>>14140734
>>14140793
see as this is a thing, I want the ryu's too

>> No.14140828

I'm going to send a Wurm into the Sun!

>> No.14140831

>>14140828
What are you going to do when the sun goes supernova because you did that and the poor Wurm gets sad and lonely and depressed because blames herself for causing the apocalypse?

>> No.14140837

>>14140831
Maximum comforting

>> No.14140839

>>14140837
But you'll be dead. Because the sun exploded.

>> No.14140840

>>14140822
I'm totally okay with this.

>> No.14140842

>>14140831
Such is life for poor, stupid Wurm-chan.

>> No.14140848

I want to introduce the most innocent baby Wurmling to the kinkiest, lewdest fetishes!

>> No.14140853

>>14140848
I want to purge all Wurms and Alps so fags like you will stop forcing them.

>> No.14140855

>>14140853
There's no way that would work anon because they don't actually exist. Stay mad.

>> No.14140859

>>14140822
>Boss, your next mission is to rescue POWs from a centaur encampment. This contract has been payed for by the Order, but we suspect Cipher is involved...somehow.

>> No.14140862

>>14140822
>It's centaur culture to claim the prisoners only when they fall and give in during the march
>eventually a man reaches his limit, and collapses to the ground in exhaustion
>And then another
>And then another
>Until only the man in the front, squad the leader, remains, dragging the others by the chains
>Extreme exhaustion and stubborness broke his mind to the point of locking him into the loop of marching, preventing him from stopping
>He keeps looking straight ahead, walking forward
>His mental tunnel vision prevents him from noticing more and more centaurs gathering around him, worried that he hasn't stopped yet
>They start whispering among themselves, asking each other if there's something wrong with him
>He eventually bumps into one of them, and is immediately embraced by her
>He can barely hear her shouting that she can't take watching him drag heavy chains for so long anymore, followed by angry discussions with her superiors
>He looks back, only to see that he's been dragging nothing but lead balls & chains all this time
>His comrades are gone
>His eyes well up as he realizes he failed to fulfill his promise
>His promise that he'd save his comrades from these vile creatures, alone if he had to
>Gives in to exhaustion and dies right there and then in the centaur's arms

>> No.14140864

>>14140761
You'll have to take me by force between your bosoms!

>> No.14140865

>>14140859
>some Centaur has to watch as the man she dedicated her heart to is fultoned away by some Big Boss wannabe

>> No.14140871

>>14140839
My comfort transcends this mortal coil

>> No.14140874

>>14140859
You forgot to throw in blaming it on Emmerich somehow.

>> No.14140876

>>14140859
>Big Boss ends up tranquilizing and fultoning all their new wives too.
>Because Big Boss can't resist those sweet sweet A+ ranks.

>> No.14140877

>>14140842
Is this an epic /mgt/ meme?

>> No.14140880

>>14140865
Revenge > Horse pussy.

>> No.14140881

>>14140822
I for one, welcome our new horse pussy overlords.

>> No.14140884

>>14140864
I think they'd find your terms acceptable.

>> No.14140885

>>14140877
Eh, it's probably just the same nigger who's been doing it for the past few months.

>> No.14140886
File: 558 KB, 514x800, 1439237057989.png [View same] [iqdb] [saucenao] [google]
14140886

>>14138685
We must go purer.

>> No.14140888

>>14140876
Man, fultoning really does solve everything.

>> No.14140889

>>14140877
No, it's just on par with shit like Chubby Alp Senpai.

>> No.14140893

>>14140876
>Centaurs and their husbands are injected with Wolbachia bacteria to prevent parasites from infecting mother base
>Centaurs' faces when they're all infertile now

Hah

>> No.14140895

>>14140874
He's a traitor, the blame is implied from the get-go.

>> No.14140899

>>14140893
Eh, they can fix it later with Nanomachines.

>> No.14140901

>>14140895
So is Miller! He BROUGHT Zadornov to Snake so he could get Mother Base 1
And do I need to bring up the Quintuple Agent that is Ocelot?

>> No.14140906

>>14140901
Miller's been working for Cipher up until the point MSF got rekt by XOF. It's the final piece of lore revealed in MGSPW.

>> No.14140908

>>14140899
They're going to have to wait until the early 2000's for them though.

>> No.14140909

>>14140901
No shut up, revenge tho.

>> No.14140914

>>14140901
Are you seriously defending Huey?
He's a shit.
He killed Strangelove and was going to use Otacon to pilot a Metal Gear!

>> No.14140915

>>14140899
>>14140908
>not having a young, upstart succubus develop [MAMONO MANA]

>> No.14140918

>>14140862

REWIND BACK TO LIFE

>Eventually one of the centaurs can't stand the sight of this anymore.
>Against the will of her surperiors she undoes the man's bindings before he can drop dead
>She puts him on her back and just runs away from them all

>> No.14140920

>>14140893
That's not how Wolbachia works, you little shit.

>> No.14140923

>>14140918
God damn man. Even if an ending is stupid, don't be even more stupid and force another one.

>> No.14140924

>>14140915
I just imagined how that Succubus got recruited into the Diamond Dogs.
It involves the Rocket Punch.

>> No.14140926

>>14140915
>Costs a shitload of GMP
>Takes all your resources
>The enriched uranium in your nukes too
>Makes all staff into incubi and succubi who don't do shit but have sex all day
>Mother base becomes a demon realm
>Even your buddies become monstergirls

Fuck that noise.

>> No.14140930

>>14140926
...I never said it was a good plan.

>> No.14140931

>>14140920
>"Code Talker possessed a strain of the bacteria genus 'Wolbachia' that could, by turning the male version of the parasite to females, halt the onset of symptoms, but would also make the host infertile."

>> No.14140933

>>14140926
You should probably slap her and tell her not to do that then.

>> No.14140935

>>14140914
I wasn't the only one who immediately thought of Gendo right?

Or maybe I'm crazy, who knows.

>> No.14140937

>>14140931
>vidiya "science"

>> No.14140940 [SPOILER] 
File: 445 KB, 1136x1916, 1443200801708.png [View same] [iqdb] [saucenao] [google]
14140940

>>14140933
>>14140930
Don't even get me started on what would happen to Sally if [MAMONO MANA] was developed.

>> No.14140943

>>14140924
I guess that's less funny but faster than a supply drop on the head.

>> No.14140947

>>14140940
I am not ok with this.

>> No.14140948
File: 136 KB, 757x854, Outer_Heaven_Uniform_.jpg [View same] [iqdb] [saucenao] [google]
14140948

Monstergirls in modified MSF/DD uniforms.

>> No.14140952

>>14140935
Trust me, you're not the only one.
At least Gendo actually loved his wife.

Also, I heard somewhere that Psycho Mantis' name translates out from Russian to "Third Child". Kind funny when you think about it.

>> No.14140962

>>14140948
.less please this.

>> No.14140964

>>14140827
>A ryu along her husband and mother enjoying peppermint tea.

I gotta say, that is a nice thought beast gave us

>> No.14140967

>>14140943
Now I'm just imagining some Diamond Dog soldier out in the field calling in a supply drop.
>"Soldier are you sure about this?"
>"Yeah, yeah, yeah. Do it."
>"That's right in the middle of the marked enemy outpost.
>"I know, do it!"
>About a minute later, a box falls from the sky and knocks the tough looking Red Oni in the middle of the outpost out cold, shocking her friends who are quickly tranquilized by the Soldier.
>He allows himself a solid two minutes of laughter before fultoning all of them.

>> No.14140970

>>14140924
>>14140943
>not beating her with the tranq pistol

>> No.14140972

>>14140962
The only thing he'd do with the outfits is draw Whorehi in one since that's the only thing he draws that isn't Bobs shit.

>> No.14140975

>>14140970
It's funnier to imagine a Succubus getting punched in the face at 20 MPH by a rocket fist.

>> No.14140978

>>14140972
we should keep yelling at him to make different stuff
like that one kikimora from one of punladins works (I think it was the paladin program one)

>> No.14140979

>>14140967
Now there's a guy who earns his paycheck.

>> No.14140982

I wanna slap a Wurm and break my hand

>> No.14140988

>>14140964
I want art of this, they other suggestions suck

but why peppermint tea?

>> No.14140990

>>14140978
The pervert with the masochistic tendencies that got tied up and stuffed into the closet? Heh, closet pervert.

>> No.14140998

>>14140982
That's why you slap them in the soft bits instead of on their scales

>> No.14141003

>>14140982
How do you break your hand from slapping something? You're the one applying force on a resting wurm, how can you be so retarded as to slap her so hard you get completely shit on by Newton's third law?

Fuck man, she's smarter than you at this point.

>> No.14141004

>>14140990
Yeah that's the one.
there is so much he could do!
>Punladins maso kiki
>the centaurs from vengance
>The ryu's from beast's thing
>that new dragon woman ELH made

so and so much more and he focus's on bob.

>> No.14141009
File: 192 KB, 700x781, 1433903582085.png [View same] [iqdb] [saucenao] [google]
14141009

Which MG do you want to give headpats to the most?

>> No.14141010
File: 86 KB, 435x600, 1_5_51.jpg [View same] [iqdb] [saucenao] [google]
14141010

Chiyou best monstergirl.

>> No.14141011

>>14141003
>Slapping things like a bitch
I may have a broken hand but at least I'm not a pussy like you

>> No.14141012

>>14141009
Hellhound.
Or any canine monstergirl really.

>> No.14141015

>>14140988
>why pepermint tea?
because in beast's work, the ryu gains a liking to peppermint tea and at the end makes some for her mother

>> No.14141016

>>14141004

> that last one

He's silently updating too if you're paying attention. Does have a big old WIP tag on it though.

>> No.14141018

>>14141009
my daughteru

>> No.14141021
File: 679 KB, 944x1280, 9cc139ad06d723363d7c53c013fa0849.png [View same] [iqdb] [saucenao] [google]
14141021

I want an Anubis to sit on my dick all day and drain every bit of fluid from me!

>> No.14141022

>>14141009
hiro

>> No.14141029

>>14141016
really?
sweet! I take a look at it later.

>> No.14141031

>>14141009
Dunno. Kobold came to mind first, they look really pettable.

>> No.14141035

>>14141009
Lich. Then her Shoggoth servant.

>> No.14141040

>>14141011
>Slapping things you very well know will fuck you up

No, you're a fucking dumbass with a broken hand, that's what you are.

>> No.14141042

>>14141009
Alps

>> No.14141043

>>14141035
You slut.

>> No.14141045

>>14141021
>Metaphor about the suction power of anubis pussy/blowjobs and quicksand goes here

>> No.14141047

>>14141042

All of them?

>> No.14141052

>>14141047
All of the alps.

>> No.14141055

>>14140822
Try as they might I will never give in.

>> No.14141058

>>14141009
Yeti, I want to see her ahoge waggle

>> No.14141064

>>14141009
Every single one of them! I'll write my own version of the Encyclopedia that's just reactions from different species to head patting!

>> No.14141070

>>14141009
Ushi-Oni. Something about big girls insisting they don't want head pats is adorable.

>> No.14141072

>>14141040
>Implying your wimpy opinion means anything

>> No.14141073

>>14141064
I wish you well in your endeavor.

>> No.14141077

>>14141009
A slime because it would make a funny noise.

>> No.14141078

>>14141072
There's a clear difference between manliness/courage and retardation, Mr. meathead.

No excuse for being this stupid.

>> No.14141080
File: 453 KB, 900x950, b51d991715503667f930301530eb877f.jpg [View same] [iqdb] [saucenao] [google]
14141080

>>14141021
I want an Anubis to put a collar on me and make me her pet.

>> No.14141082

>>14141080
>An Anubis will never try to act uncaring and aloof around you.
>You'll never know better because she can't stop her tail from wagging every time she sees you.
God damn it.

>> No.14141084

Wonder what it's like being a farrier for centuars, minotaurs, and baphomets.

>> No.14141088

>>14141064
Thank you for applying for the task of traveling the world and record monster head pats. Your first assignment will be the Himalayas, your targets are Yuki-onnas, Wendigos, Glacies, Yetis. You will be picked up at 0400, be prepared and dress warmly.

>> No.14141092

>>14140695
>all of the Kiki stories we have

which are where exactly?

>> No.14141093

>>14141080
Just make sure you're a good pet.

http://gelbooru.com/index.php?page=post&s=view&id=1469887

>> No.14141109 [SPOILER] 
File: 388 KB, 1280x1728, 1443203956367.png [View same] [iqdb] [saucenao] [google]
14141109

She's a big girl.

>> No.14141112

>>14141109
Them some dick sucking lips. Also, delete it before you get baleeted.

>> No.14141113

>>14141109
a damn great pic

>> No.14141114

>>14141092
http://pastebin.com/aSReGH1E
http://pastebin.com/g4TKqSxf
http://pastebin.com/fqcdazZy
http://pastebin.com/AuwYNWCg
Losensis also wrote one, but I can't find it.

>> No.14141115

>>14141109
Isn't this drawn by the same guy who made a futa yuri slime OC donut steel?

>> No.14141117

>>14141109
>Modeseven
Fuck off, he's just as bad as Incase and Shadman.

>> No.14141119

>>14141109
Imagine fucking the regular sized girl on top of the giant and seeing her getting all flustered at the action going on. Occasionally poking here and there with one of her huge fingers and wondering what it would be like.

>> No.14141124

>>14141117
What a moron.

>> No.14141125

I'm board in this political science class.

Give me a MG and a vague idea, and i'll write a greentext for you.

>> No.14141128

>>14141109
Upload this somewhere, I wanna see what the fuss is about

>> No.14141130

>>14141117
Judge the image not the artist.

I don't like a lot of modeseven's stuff either but I'd be lying if I said that picture wasn't great.

>> No.14141134

>>14141125
Pay attention you fucking idiot.

>> No.14141136

>>14141114
http://pastebin.com/YcsgMgF6

>> No.14141137

>>14141128
http://i.imgur.com/x5xl4pu.png

>> No.14141138

>>14141115
If I recall, she's only futa when she absorbs anything with a dick into her body and starts churning them up into yoghurt.

Artist's preferred choice of words, right there.

>> No.14141140

>>14141136
Thanks mang.

>> No.14141141

>>14141125
Anubis drill sergeant.

>> No.14141148

>>14141134
Anon, GPA doesn't matter in college, nor does paying attention to anything that isn't your job training.

>> No.14141156

Celtic Monstergirls

>> No.14141157

>>14141125
Lilim Trump

>> No.14141160

>>14141157
Don't ruin the Trump like that.

>> No.14141165

>>14141109
>reverse search
>look up everything else this artist has done
>cock vore, anal vore, transformation vore, unbirth
Well, at least there are a couple decent images he's done.

>> No.14141166

>>14141156
First thing that came to mind was a monster girl dressed like Celtic Warrior from Yugioh.

>> No.14141171

>>14141160
well, what MG do YOU think the Trump should be?

>> No.14141176

>>14141171
Which one is the most anti-monster?

That one.

>> No.14141181

>>14141171
We already know Elf Trump is the manliest of elves, building his giant magic wall to keep the rapists out.

>> No.14141183

>>14141171
>>14141160
Trump LostTheElectionman

>> No.14141184
File: 165 KB, 1024x751, anna_wip_by_karbo-d6z445w.jpg [View same] [iqdb] [saucenao] [google]
14141184

>>14141165
I like vore

>> No.14141186

>>14141184
Why?

>> No.14141187

>>14141184
What the fuck is a lamia gonna do with a wrench in the middle of a forest?

>> No.14141188

>>14141183
Can't stump the Trump.

>> No.14141196
File: 686 KB, 1746x1201, RatSabbathbestSabbath.jpg [View same] [iqdb] [saucenao] [google]
14141196

I'm beginning to think Nyanon got captured by Skaven girls at this point. That isn't what happened is it, Anon?

>> No.14141200

>>14141187
Fix things.

Throw it at passing prey

>> No.14141202

>>14141137
That's pretty nice

>> No.14141204

>>14141196
Don't be silly, man-thing.

>> No.14141209

>>14141200
>Throws a wrench at a bypasser
>Unfixes their head and knocks them out

I see she's pretty good at fixing shit. Looks like somebody needs to fix her attitude.

>> No.14141212

>>14141148
If you want your poli sci degree to get you started in a career in burger flipping, by all means, don't care about your GPA

>> No.14141220

>>14141186
Because it makes my dick twitch.

>> No.14141224

>>14141196
>Implying skaven girls exist

Whats next, beastmen are real?

>> No.14141225

>>14141212
>GPA
>Worth shit
It's all about who you know in this day and age.

>> No.14141227

>>14141212
He's right if he's a business or communications major. He's wrong if he's getting any kind of real degree or wanting to continue higher into grad school.

>> No.14141235

>>14141204
>>14141224
Yeah but we know there's primordial lizard girls who do snu-snu out there. Gods only know that theres a Large Mouse huffing Dark Matter and turning into Skaven, Anon!

The Underfolk exist!

>> No.14141256

>>14141224
of course they are

greentext about taking in a nice lustrian lizardgirl trying to find a new home after the destruction of her homeland when

>> No.14141257
File: 55 KB, 400x308, pseudodragon.jpg [View same] [iqdb] [saucenao] [google]
14141257

When will the Sabbath churn out Pseudodragon Familiars for aspiring onii-chans?

>> No.14141267

>>14141212
No corporations care about your GPA. It's about having a degree to begin with and in a field that actually matters. Networking is the other big advantage, one conferred by going to a more 'prestigious' college. At my old job the head of the company and his VPs all went to the same college. I have a feeling GPA and such mattered not much at all.

Political Science is one of those bullshit courses that many universities make you take to make you more 'well-rounded' and give you 'soft skills.' In real world terms, it's simply a means for the college to pad out degrees to make more money. Education is a business first and, well, education second. Why do you think so many schools champion their facilities more than the quality of their education? Why they use so many TAs to lead a class?

>> No.14141268
File: 224 KB, 958x1356, pleasedontpetme.jpg [View same] [iqdb] [saucenao] [google]
14141268

>>14141070

>> No.14141277

>>14141257
This reminded me of something yesterday when people were talking about dragon nests. What are those slave dragonlike abominations wizards make from dragon eggs? I can't remember their names for the life of me.

>> No.14141278
File: 77 KB, 600x598, 1441599360141.jpg [View same] [iqdb] [saucenao] [google]
14141278

>>14141256
>Lustrian Lizardgirls
>Ever

No. Bad Anon. Bad.

>> No.14141280

>>14141268
>those cracks
Eh, I'll still try to pet her.

>> No.14141281

>>14141268
10/10 would pet and take responsibility.

>> No.14141282

>>14141268
I'm gonna pet her until she rips that seal off and headpats me too

>> No.14141285

>>14141278
shoggocks pls

>> No.14141286

>>14141268
That head's gonna get pat. And I'll pull that tail, too, just to see how she reacts.

>> No.14141293
File: 310 KB, 991x702, 1442718974315.jpg [View same] [iqdb] [saucenao] [google]
14141293

Brave warriors, join me and lets go explore some dungeons

>> No.14141295

>>14141293
I don't want to.

>> No.14141297

>>14141268

This and balloon Ushi need to be cleaned up and colored

>> No.14141298

>>14141295
why not? as they say "fortune favours the bold"

>> No.14141302

>>14141293
I always fancied making a monstergirl game that combined the mechanics of recttear and harvest moon

>> No.14141305

>>14141298
I don't like dungeons.

>> No.14141307
File: 560 KB, 496x702, 1436875554582.jpg [View same] [iqdb] [saucenao] [google]
14141307

>>14141285
>Imfuckingplying

>> No.14141309

>>14141302
recttear is that game where your a shop keeper right?

>> No.14141311

>>14141278
>huge Kroxigor girls with big fat tits and egg laying hips
>ranks upon raks of toned Saurus hotties
>limper loli Skinks
>plump, ara ara Slann

I'd take any or all of that.

>> No.14141313

>>14141268
She's gonna get pet, and she's gonna like it. Then I'm going to like what happens after.

>> No.14141315

>An adventurer trudged into town trailed by a small figure loaded down with baggage.
>The handsome young man was loudly berating his follower.
>"Challenger was a trained warhorse. Replacing him is going to cost me twice what your mangy hide is worth! Maybe three times! That's if I even can find a replacement here."
>The burdened Kobold protested weakly between gasps that the horse breaking his leg wasn't her fault.
>"You probably spooked him with your smell," the adventurer muttered sourly. "Flee ridden little mongrel. I knew I should have bought an elf slave instead. That'll teach me to go for the bargain."
>The man nearly collided with an old woman in the street while grumbling and his face changed dramatically to one of concern.
>"Pardon me, Ma'am. Are you alright? I wasn't watching where I-" He noticed a bushy tail drooping behind her and cut off mid-sentence.
>The kindness left his face as abruptly as it had come.
>"Ah." He sighed. "Watch where you're loitering, hag, lest you find yourself on the wrong end of my sword."
>The old woman looked up at him and her eyes sparkled in an impossibly wrinkled face.
>"Such ugly behavior from such a pretty boy. Haven't you ever heard 'what goes around, comes around'?"
>He sneered. "I doubt principles of karma apply to corrupt vermin such as yourself."
>Her mouth quirked almost into a smile. "So it's only monsters you have a problem with, then? You don't have such a charming way with others?"
>The man began to lose his patience. The creature was wasting his time.
>"Only a fool or a scoundrel would think of monsters with other than contempt. I wish I never had to see another one of your filth again. Now step out of my-"
>"Done."
>He frowned at the interruption.
>"I'll grant your wish. You'll never see another monster again. Gahakakaka!"
>The man spat in disgust and left the crazy old woman laughing in the street.

>> No.14141316

>>14141268
That Ushi tail wag.

>> No.14141317
File: 166 KB, 400x400, 1928.png [View same] [iqdb] [saucenao] [google]
14141317

>>14141293
>Dank dungeons

>> No.14141318
File: 678 KB, 1024x768, rect trap.jpg [View same] [iqdb] [saucenao] [google]
14141318

>>14141309
yes

>> No.14141319
File: 849 KB, 957x933, lustria when.jpg [View same] [iqdb] [saucenao] [google]
14141319

>>14141311
mah nigga

>> No.14141320

>>14139998
I actually have a certain stump in the local woods I like to sit on and enjoy the view whenever I'm there.
The picture and story make me feel bad about it somehow.

>> No.14141323

>>14141305
But the trill of dodging traps, the glory of defeating monsters and villans, the joy of finding gold and a echidna

>> No.14141325

>>14141323
Nah, too much effort.

>> No.14141327

Oh ho?
http://exhentai.org/g/856964/955971534e/

>> No.14141329

>>14141317
>Having weak resolve
As expected of m-types.

>> No.14141331

>>14141327
>korean

>> No.14141332

>>14140131
You'd be the female though. Asked to do al the hard shit, relying on the Manticores only for protection.

>> No.14141333

>>14141318
>Lich in disguise.jpg
Gathering materials to see which cosplay outfits get men(her husband)the horniest.

>> No.14141336

I just wanna go to sleep on a pile of Wurms. Or just a single Wurm. I need it. My hands are shaking thinking about it.

>> No.14141337

>>14141331
That and the Chinese one are the only ones I can find.

>> No.14141339

>>14141315
More?

>> No.14141340

>>14141325
Fine, more gold for me!

>> No.14141342

>>14141327
>the chinese and korean versions showed up before the raw
How am I supposed to translate it like this?

>> No.14141346
File: 145 KB, 1300x921, 1429941190742.jpg [View same] [iqdb] [saucenao] [google]
14141346

>>14141307

At least post the feathertits with actual tits.

>> No.14141347

>>14140669
I don't mind the avatar fagging with his OC, because it's OC. Not like he reposts the same shit, at least if he does I haven't seen it before. It's like saying a writefag avatarfags with his updates every post he makes.

>> No.14141349

>>14141336
I want the same thing but with Holstaurs.

>> No.14141354
File: 41 KB, 520x390, 1435193399398.jpg [View same] [iqdb] [saucenao] [google]
14141354

>>14141346
Didn't feel like it so sue me I guess.

>>14141319
>>14141311
I repeat.

>Wanting Lustria
>EVER

>> No.14141357

>>14141293
>you will never be the wizard

>> No.14141358

>>14141347
>because it's OC
Drawfags constantly reposting their self-inserts ad-nauseum doesn't count as OC.
That, and if you're familiar with the sites rules, you'd know its stance on avatarfaggotry.

>> No.14141359

>>14140548
Fat-Bottomed Lich.

In a Playboy Bunny Leotard. With bunny ears.

>> No.14141360

>>14141342
Learn korean I guess?

>> No.14141362

>>14141357
>>14141293
>Dullahan ironically chasing the guy carrying gold around

At least the wizard gets a hot waifu

>> No.14141364

>>14141295
nice meme

>> No.14141368

>>14141358
It could fall under just posting new art though, and not avatafagging. Also, seems like something got lost in translation, or An Hiro wants to make avatarfagging a thing. That aside, is less just posting reposts of his stuff? I thought it was new.

>> No.14141369

>>14141364
You're an idiot.

>> No.14141372
File: 794 KB, 1200x1600, 6lQsF7y.png [View same] [iqdb] [saucenao] [google]
14141372

How do you keep your waifu in line, anons?

>> No.14141374

>>14141295
https://www.youtube.com/watch?v=U-9tAqdd_4Y

>> No.14141375

>>14141082
Goddammit anon...my heart.

>> No.14141376

>>14141368
Nigger he's still using an avatar each time he posts, are you some special breed of retard?

>> No.14141381

>>14141372
threaten her with the spoon

>> No.14141383

>>14141315
>As the man walked through the streets looking for a stable he noticed many people staring at him.
>He did not have to think long to figure out why.
>He led the Kobold into a nearby alley and began taking the luggage off her.
>"Goodness, what was I thinking? Strapping all my gear to my hound like this, those people must think I'm a lunatic."
>The Kobold watched nervously but didn't have the courage to question him.
>When he was done he left the alley carrying all the bags himself. The Kobold girl waited in place, confused and fidgeting.
>"Come on, girl!" he called to her cheerfully.
>She flinched and ran to catch up.
>"Come to think of it, I haven't given you a name yet, have I?" He pursed his lips and studied the Kobold.
>"I've got it. Scout. From now on, your name is scout. Scout." He pointed to her a repeated loudly and firmly. "Scout."
>"I...y-yes master. I'm Scout."
>"Ahahah, it seems like she already gets it. What a clever doggie!" He plopped a hand down on top of her head and gave it a vigorous rub.
>The stunned Kobold girl stiffened and darted embarrassed looks at the people watching. Her tail wagged hesitantly.
>"Come along now, Scout. We've got to see if we can't find ourselves a decent horse."

>> No.14141384
File: 5 KB, 198x148, listen.jpg [View same] [iqdb] [saucenao] [google]
14141384

>>14141372
I dont have a waifu

>> No.14141386

>>14141372
I tell her that it would hurt my feelings.

>> No.14141387

>>14141372
Do you hurt her whenever she gives you critiques on things?

>> No.14141391

>>14141383
Pretty good. I like it, continue.

>> No.14141392

>>14141171
he would be an alp, but it would be a closely guarded secret to all but a few people that he's actually a she

>> No.14141394

>>14141372
I keep her such a dazed, heart-pupiled, cum dripping mess that she cannot challenge my will.

>> No.14141395

>>14141376
>Nigger he's still using an avatar each time he posts
Yeah, I'm just saying, if it's new art, who cares?

>> No.14141396

>>14141372
I don't come home from work for several days, don't answer my phone and make sure to let it ring, and then return home only when she fills my voicemail with sobbing episodes asking when am I coming home.

>> No.14141399

>>14141383
...he's gonna wind up buying a centaur or something, i'n't he?

>> No.14141400

>>14141395
>new art
Are you seriously counting his donutsteel as "new art"?

>> No.14141401

>>14141396
That's just wrong.

>> No.14141402

>>14141395
Stop sucking his dick please.

>> No.14141403

>>14141395
They're quick sketches drawn for the intended use of avatarfagging. Nobody else's gonna use them for anything because it has no other uses.

>> No.14141406

>>14141372
The dick.

>> No.14141407 [SPOILER] 
File: 1.26 MB, 800x1132, 1443209733750.png [View same] [iqdb] [saucenao] [google]
14141407

Comes the nocturne one.

>> No.14141408

>>14141395
Just accept that people would rather have nothing than .less' little sketches of his waifu, and move on.

>> No.14141412

>>14141375
>She'll never keep a picture of you beneath her pillow.
>She'll never look at it every night before she goes to bed.
>She'll never steal one of your shirts because it's covered in your scent.
>She'll never secretly commission a daki of you and cuddle it every night.
>She'll never drag you to her room during the full moon.
>She'll never finally give in to her feelings and confess her love for you.
>She'll never press up against you seductively and take in as much of your scent as possible.
>You'll never wake up the next morning with her sleeping on top of you with a little smile on her face.
If I have to suffer this, so do you.

>> No.14141418

>>14141359
It's not going to happen.

>> No.14141419

>>14141372
Triple suplex.

>> No.14141422

>>14141412
Damn you anon...damn you! So much that could be ;_;

>> No.14141423

>>14141400
New somethings.
>>14141403
Hey I never said it was good, or useful, but I know there are a few of you here who save literally everything. I'm not of the camp that says if I don't need something it's better if it were never made.

>> No.14141424

>>14141400
Are people not allowed to draw unless it's a copy of another character?
Guess what anon, everything is a 'donut steel.'

>> No.14141425

>>14141372
Headpats, Cuddles, and ear scratches.

>> No.14141429

>>14141082
>An Anubis will never try to act uncaring and aloof around you
>You'll never take it seriously and cease interaction with her, moving on with your business

I'm too busy to be the guinea pig of her mindgames.

>> No.14141431

>>14141311
The only times Warclap shit is acceptable is 40K since we all know Fantasy is a Gygax wankfest.

>> No.14141435

>>14141372
Give her the dreaded disappointed husbando stare.

>> No.14141436

>>14141400
>his donutsteel
So how mad would all y'all get if someone were to start drawing pictures of their own characters? Asking for a friend.

>> No.14141438

>>14140734
this sounds intresting
anyone got a link to this "beast"?

>> No.14141443

>>14141311
>egg laying hips
I want to watch a chubby lizardgirl lay eggs!

>> No.14141445

>>14141436
Depends on whether or not they do it for nearly 100% of the time like .less.

>> No.14141448

>>14141431
Fuck off, 40kid.

>> No.14141450

>>14141082
>You'll never think that it's wagging because she's thinking about a different guy
>You'll never apologize for bothering her, and take your leave so she can go spend time with them, rather than keep her preoccupied wasting her time around you.

>> No.14141452

>>14141431
Is this bait

>> No.14141453

>>14141436
Certain autists will always be upset at everything that isn't a carbon copy of something else. Most of said autistic faggots are from /tg/.

>> No.14141463

>>14141422
>She'll never start flirting with you more after that night.
>She'll never start sneaking under your covers every morning to "deal" with your morning wood.
>She'll never sit on your lap when she watchs movies with you.
>She'll never "accidentally" walk into your room while you're changing.
>She'll never send you an email that's just a picture of her posing seductively titled "Tonight, My Place".
>She'll never cry tears of joy and hug you while screaming "Yes, Yes, Yes!" when you propose to her.
SUFFER WITH ME ANON.

>> No.14141465

>>14141450
Then she'd just start stalking you because she's afraid of losing you anon.
When she can't take anymore you'll soon find a crying Anubis pressed up against your window.

>> No.14141470

>>14141463
>posing seductively
>Anubis
Hilarious.

>> No.14141472
File: 1.18 MB, 1127x1600, 1439164412383.png [View same] [iqdb] [saucenao] [google]
14141472

>>14141412
>you will never proudly show her pictures of you together with your Pharaoh girlfriend

>> No.14141475

>>14141443
>A Kroxigor
>Ever being chubby

Anon, please.

>> No.14141480

>>14141472
Fuck you anon.

>> No.14141482

>>14141463
>Monstergirls walking in while you're changing
>They all cover their eyes and go "I-I'm sorry" before reluctantly leaving with a blush, regardless of race or personality

>> No.14141487

I wanna burp my baby Wurm daughter!

>> No.14141488

>>14141463
Such wonderful fantasies these are...Fantasies and nothing more ;_;

>> No.14141489
File: 91 KB, 800x509, thiskillsthekiki.png [View same] [iqdb] [saucenao] [google]
14141489

>>14141435
>disappointed

>> No.14141493

>>14141472
pls Pharaoh a boring.

>>14141465
And I would let her in, still as oblivious as ever, but it's hard to remain so while hugging a teary-eyed Anubis, comforting her while asking her what's wrong.

>> No.14141494
File: 53 KB, 158x158, 1392344628699.png [View same] [iqdb] [saucenao] [google]
14141494

>>14141482
I'd rather have one cock an eyebrow and sport a little grin before excusing herself calmly.
Or go full-on rape smile.

>> No.14141496

>>14141487
>Put baby Wurm on your shoulder, her face facing behind you
>Burp her
>High speed projectile rocks explode from her little Wurm mouth, shotgunning into whatever was behind you and likely going through it

>> No.14141501

>>14141480
Her uncaring and aloof facade didn't work the way she intended.
The cunty buttmutt reaped what she sowed in that regard.

>> No.14141504

>>14141463
>She'll never send you an email that's just a picture of her posing seductively
I can just imagine an Anubis who's always been highly serious and no fun allowed until getting into a relationship trying to get a decent pose.
Spending countless hours checking websites and trying to copy what she sees, failing at getting them right. Eventually settling for an awkward selfie in an open shirt of yours that's too big for her, looking more cute than sexy.

>> No.14141508

>>14141489
I bet she put raisins in a batch of cookies while trying to slowly progress towards healthier habits.

>> No.14141509

>>14141496
Should have made sure the wife was feeding her rock candy instead of rocks.

>> No.14141510

>>14141475
He never specified it as a Kroxigor. I'd take either a chubby lizard girl or a brick shithouse one.

>> No.14141511

>>14141504
Suddenly I can't help but think of Liz Lemon from 30 Rock, in that regard.
Every attempt she makes to pose or act sexy in earnest just ends up looking hilariously awkward and uncertain.

>> No.14141512

>>14141501
She was simply trying to maintain a facade of professionalism; and consistently failing because adorable wagging tail.

>>14141504
There goes my heart. Would love to get art of this...

>> No.14141515
File: 266 KB, 700x900, 1439108920274.png [View same] [iqdb] [saucenao] [google]
14141515

>>14141489
I want a sadistic Kiki to bully my dick and slap me around!

>> No.14141516

>You'll never have a monstergirl partner-in-crime who likes to do stupid things and get in silly situations with you for shits and giggles and laugh it off together
>You'll never pull off the sickest pranks and plans until you become known as the town's troublemakers

Life should have more meaning than this.

>> No.14141518

>>14141482
I just imagined an Oni walking in on a guy, shifting her eyes down and just saying "Nice." before shutting the door.

>>14141488
>She'll never take your dick balls deep inside her and then lay down on top of you.
>She'll never refuse to shake her hips until you promise to impregnate her.
>The two of you will never have mindblowing, passionate sex until you're sure she's pregnant.
>She'll never collapse on top of you and start repeatedly telling you how much she loves you.
>You'll never have daughterus with your Anubis wife.

>>14141493
This is the part where she tackles you to the ground and tells you she loves you before making you take her first kiss.

>> No.14141524

>>14141504
That's cute as hell man.

>> No.14141528

>>14141515
kikis are love

>> No.14141542

>>14141528
I wish for a Hating Kiki.

>> No.14141551

>>14141509

But rocks aid a wurms digestion.

>> No.14141557
File: 3.17 MB, 3200x2000, AnubisBooks.png [View same] [iqdb] [saucenao] [google]
14141557

>>14141518
All too, too good...well, maybe someday, there might at least be VR.

>> No.14141560

>>14141518

I wouldn't want kids right away.

I'd want a bit of time with just me and the waifu.

>> No.14141581

>>14140169
It seems that wasn't enough for janet to kick me out for.

>>14141516
>The big job will never go horribly awry when an off-duty cop pulls a gun
>You will never be able to look your partner in the eyes again after the cop and some wannabe hero tries to take you down only for them to meet their demise
>You will never flee for the border while trying to talk your monstrous grill partner into surrendering
>She will never use the wonders of duct tape to keep you quiet and subdued
>She will never enlist the help of shota smugglers to take you both across
>You will never live out your days running from the law but scared to death of the yandere monstrous grill you once called friend

>> No.14141587

>>14141581
>End up with one person dead and us running from the law forever
>She turns yandere
What the fuck how did we go from pranksters to actual criminals?

>> No.14141603

>>14141515
Delicious, small, palmable Kiki lumps. Made for fondling.

>> No.14141605

>>14141383
>"Greetings, good stablemaster. I am Sir Jeffery Non, Knight of Aymous. I'm looking to buy a replacement mount. A trained warhorse if you have one, gelding or mare preferred."
>The confused stableboy looked around for his boss. She was standing nearby looking over the ledgers but the knight was definitely talking to him.
>"Uh...I'm not..." he pointed to his boss. The Centaur was obviously the one in charge, anyone who looked twice could see it just by the way the two were dressed.
>"Ah!" The knight shouted. "What luck! Such a beautiful creature!"
>The Centaur glanced up from her work at his shout and saw the knight walking toward her energetically.
>He circled around her, running his eyes over her body admiringly.
>She blushed at the examination, fighting the urge to straighten her skirt. "P-pardon, sir? I don't believe we've-"
>"Yes, yes," he murmured to himself. "Great lines, perfect proportions. He even has Challenger beat. I don't think I've ever see such a beautiful animal. I don't recognize the breed, though. Could it be something from the south?"
>"B-beautiful you say," the Centaur stuttered. She moved her arms to cover her breasts though her clothing was already quite modest. "Don't think you can cloud my mind with flattery. I...I'm not giving you any discounts!"
>She blushed further when the knight stepped up face to face with her. He gently cupped her cheeks and stared into her eyes.
>She tried to look away but he held her in place. She was breathing heavy and protesting weakly under her breath about indecency. Scout and the stableboy watched with red faces, uncertain if they should stop him. Or maybe step outside.
>The Knight suddenly nodded to himself. "Yes, good."
>"W-we can't. I...GAHUwa." She trailed off when he stuck his fingers in her mouth and held it open to inspect her teeth.

>> No.14141607

>>14141605
>Satisfied, he walked around her body once more, carefully feeling her legs, looking for sores or old injuries.
>"P...pervert," she panted, still flushed. "I-I'll call the guards. I will!"
>After feeling her hind legs he lifted her skirt out of the way and inspected her genitalia. "Ah, a mare then. Good, good."
>He nimbly dodged a kick and patted her behind. "Haha, there there. She's got fire in her alright. Definitely a warhorse." He turned to ask the stableboy, "How much do you want for her?"
>"Want for me!?" she repeated. "I am not a thing, you...you m-molester!"
>The stableboy passed a worried look between his boss and the knight. "Uh...I don't think I can sell-"
>"I'll give you 20 gold."
>"Done."
>"Hey!" the Centaur protested but the two men ignored her.
>"Do you need saddle and bridle too? I can throw them in free of charge."
>"Thank you, but I have my own tack. I'd like if you could help me get it on her though, she seems a bit skittish."

>> No.14141609

>>14141605
>>14141607
Does he perceive monstergirls as actual animals or something?

>> No.14141611

>>14141587
A lot can happen in the heat of the moment. Pranks are gay so I thought I'd spice it up a bit. These threads often forget that most of these monsters are based upon monsters and instead of sexing everything, some could kill a man if she or her husbando were threatened. And yandere is just a broad word, paranoid and possessive would fit better but I like my memetexts shorter.

And now I'm thinking 'From Dusk til Dawn' with MGs.

>> No.14141612

Fairies and Meeces got the short end of the Mamano stick.
half the time the penis fucking them is 3/4 the size of them.

>> No.14141619

>>14141551
That's crocodiles, not wurms

>> No.14141624

>>14141619
Cockodiles.

>> No.14141627

>>14141612
Giant Mice are at least 3-4 feet in height, anon.

>> No.14141633

>>14141611
It was a little bit too exaggerated. I'd be fine if it ended with one of us being chased locked up after doing some accidental property damage, and the other trying to get them out, instead of being stupid enough to end up killing somebody and having to jump the border like mexicans. The sudden yandere turnaround was uncalled for too.

>> No.14141641

>>14141609

>>14141315
>"I'll grant your wish. You'll never see another monster again. Gahakakaka!"

>> No.14141643

>>14141619

You're right.

Rocks don't aid a wurms digestion, wurms digest rocks.

Where do you think they get the iron in their diet.

>> No.14141644

>>14141641
Oh, I'm retarded.

>> No.14141647
File: 253 KB, 500x706, 2013-08-25-601936.jpg [View same] [iqdb] [saucenao] [google]
14141647

>backpacking through noble Nippon
>you're taking pictures of abandoned places and nature
>you set out for an abandoned village you've heard about
>the whole place is decaying and empty, pictures galore
>you wander around the area and you happen to find an abandoned shrine, much older than the village itself
>"ara~ ara~ a human man...?" the deceptively mature sounding voice comes from a loli looking kitsune sitting on the shrine's steps, where she wasn't, just seconds before
>she brushes a pale hand across your cheek, and a fluffy tail across your chest "mmmmmm, I haven't been with a human man in so long, I am 2000 years old after all, hence my massive knowledge of all things."
>you blush, stunned
>"Ohohohoho~ turned on by this form of mine? a child's? truly despicable. I can change my appearance at will but I choose this one because it flusters you so~"
>"come lay with me human~" she guides you by the hand to a perfect, sunny glade lined with soft green moss
>she lies down and motions you to make your move
>you open her shirt, and pull down her skirt, then you pull out your engorged member
>"o-oho-o-ohoh-h-hoh-ho, s-so this is it h-huh?" she looks afraid and blushes, fear in her eyes
>you roughly grip her hip with one hand and your dong with the other, ready to guide it in
>"NOOOOOOOOOOOOOOO!!!!" she bursts into tears
>"I LIED. I LIED. I LIED. PLEASE NO!" she says, sobbing, now holding her knees
>"I-I'm only 14, I've been alone for so long, I heard this was what we were supposed to...do, I don't know what I'm doing, please, this is so scary!" she looks at you pleadingly, cheeks wet with tears
>you're now flaccid and feel like a monster, you have no choice
>you zip up your pants and sit beside her, rubbing her back and giving her head pats as she continues crying
>you've found an unexpected daughteru, who'll turn into your waifu soon enough

>> No.14141651

>>14141647
>"come lay with me human~"
lel no way fag

>> No.14141653

>>14141643
Exactly.
>Where do you think they get their iron
From eating iron ore, duh.

>> No.14141663

>>14141653

That was a rhetorical question you wurm.

>> No.14141664
File: 531 KB, 1000x1414, e24e4aba5fc1e2eedc69cb3b11842973.png [View same] [iqdb] [saucenao] [google]
14141664

>>14141647
Cute, would brush her tail to calm her down.

>> No.14141675

>>14141663
I WISH that guy was actually a wurm. Then I'd have hope of being with one.

>> No.14141678

>>14141627
What about the regular ones though?
I sure don't think they're happy about it when they're being turned into penis molds by a man's erect cock

>> No.14141692

>>14141678

Regular mice are just animals.

The name came from the time when monsters were actually monsters. Giant mice got the name because that's exactly what they were in comparison to normal mice.

>> No.14141705

>>14141515
>you wake up one morning, it's Sunday and you can tell it's late
>still half asleep, the first thing you notice is the lack of fluffy, perfumed, soft, fuzzy kiki in your bed
>where'd she go? she always wakes up with you
>you go to get up, but you're stopped
>you're hands are bound to the headboard
>"Good. You're up.~" sunlight floods the room as your heavy curtains are hastily opened
>This isn't right, you notice the chair next to your bed which she's now sitting in
>"Master, master, master..." she looks at you like a mother would look at her baby and then rustles your hair
>she gets up and turns away from you, you realize she's holding a switch
>back still turned, she begins talking "Master. I love you, but you know that, right? Okay. That bit isn't in question. The question is whether or not you get the master-servant relationship we have. See, I don't think yo do."
>"What's this about?" you ask, you're starting to sweat now, a pit forming in your stomach
>"Um, no, not quite. I'm talking. Be quiet." she begins lightly tapping the switch against her palm
>"So this relationship, right? It works in a really simple way. It's super basic stuff. Kiki's have senses, we sense greatness in men, then attach ourselves to them, then make sure they realize that greatness. We live to serve and hope only that you'll do well for us and reach your potential. Are you understanding."
>"Y-Yeah..." you respond meekly
>*THWAP* you're smacked against your bare chest with the switch
>"Wow~ did I say you could talk? I'm still speaking."
>the wound stings against the air
>"That's how most Kiki's have it. I'm not so lucky I guess. I sensed that same greatness in you, and I know my senses aren't wrong, but what're you doing with all my love and effort? N O T H I N G."
>"YOU THINK THIS IS ONE SIDED, HUH? YOU THINK I CLEAN YOUR HOUSE, COOK YOUR FOOD, TAKE CARE OF YOUR CHORES, AND LET YOU DO ALL THOSE LEWD THINGS TO ME FOR NOTHING IN RETURN?"

continuing

>> No.14141717

>>14141705
This bitch tied up a man and started beating him up and screaming bullshit at him, in a Sunday, no less.

I've never been so pissed at a Kikimora as I am now.

>> No.14141728

>>14141717
At least she didn't cut your tendons with the bolt cutter.

>> No.14141735

>>14141728
That was some stupid edge shit and I have a feeling I know who to blame for it.

>> No.14141742

>>14141705
>"NO. NO. NO. NO. NO. NO." she's in a total frenzy, each "no" is punctuated with a hit from the switch
>you're chest is now raw, beaten from all her strikes, you're wincing in pain
>"YOU. ARE. A. LOSER. LOSER. L O S E R." she's breathing heavily, clearly worn out from all her lashings
>"What's the point of all my work if all you do is sit on the computer doing nothing, have sex with me, and sleep? huh? I want a M A N, not a little boy. MAN UP." she's in a complete tizzy
>"Do your part go get a job, master. last warning. make my effort and love worthwhile. I'm tired of this."
>she looks at you like you're nothing more than a cockroach, and then throws the switch at your head
>suddenly she regains her composure "Oh, me oh my, I'm sorry master. I guess I was out of hand. Sorry. I just had to work out some issues. We have an understanding, right?"
>you nod, daring not to speak, and she smiles
>she crawls onto the bed and sets herself on top of you
>"I better take care of these, Master."
>her delicate, pink tongue begins tracing all of the wounds which she'd just made a few seconds earlier
>the sensation drives you crazy, her face is flushed and she pants while doing it
>she gets off.
>"Okay time to untie you now.~"
>the second she unties your hands, you pin her to the bed, lift her skirt, and rape her
>"MASTER~" she shouts with pure joy and ecstasy
>you two go long and hard, and by the time your done, she's passed out on the bed
>you kiss her on the head, shower, dress up, and go out to find a job

>> No.14141743

>>14141372
Looks like you're off to a good start already.

>> No.14141744

>No Hellhound to give a collar that with my name on it to mark her as mine.

Damn.

>> No.14141750

>>14141403
You say that but I've seen some of the posted around more than a few times. Some of them are pretty cute.

>> No.14141756

Being married to a Lioness Jinko sucks
Every time one of our kids are born we have to wait for about 50 different animal species to come and for a crazy old Baboon Kakuken to come hold them up.

>> No.14141758

>>14141705
>>14141742
Yeah, this bitch would be fired in a heartbeat.

>> No.14141759

>>14141742

More like that event would destroy what little self esteem she built up in me and cause me to attempt suicide since a piece of filth like me clearly doesn't deserve to live.

>> No.14141766

>>14141742
I'm kicking her out.

And they say indidualism is ruining society. Fuck that noise, this is my goddamn house.

>> No.14141773

>>14141756
>Baboon Kakuken

Woah.

MANDRILL KAKUKEN WITH MASSIVE, SHAPELY, TIGHT BLUE ASS WHEN?

>> No.14141774

>>14141759
>attempt
Man up anon, have some confidence in ending your life. Losers attempt things. Winners see things through to the end.

>> No.14141781

>>14141756
>Lioness Jinko
>Lioness
>Tiger
Wha?

>> No.14141782

A shoggoth wouldn't judge you. Shoggoth loves you just the way you are.

>> No.14141783
File: 273 KB, 500x846, 1438383085853.png [View same] [iqdb] [saucenao] [google]
14141783

>>14141782
Shoggoth always best meido.

>> No.14141786

>>14141782
She'd judge me if I surrounded her with weapons using Gate of Babylon.

>> No.14141787

>>14141782
Anon is right, maybe the Kiki should be removed!

>> No.14141788

>>14141766
>And they say indidualism is ruining society.
>individualism is ruining society

FUCKING COMMIES GET THE FUCK OFF MY BOARD

>> No.14141791

>>14141788
Amerifat pls

>> No.14141792

>No Nurglette smut
>No Bloodthirster of Khorne smut
>No Lady of Change smut
>No plumbuses

>> No.14141793

>>14141782
Remove abominations.

>> No.14141795

>>14141782
Yeah, but I also like not being decapitated.

>> No.14141797

Good to know that from now on Kikimoras will be known as some bitchy dominant asshole that will beat the shit out of you if you're lazy for one second.

Might as well rewrite the entire profile to fit that image since nobody will go by it ever again.

>> No.14141798

>>14141793
>>14141787
Shoggoths are only abominations on the outside.

No I wanna seriously headpat one, especially after this >>14141742 >>14141705

>> No.14141801

>>14141793
Love abominations. Cuddle abominations. Impregnate abominations.

>> No.14141804
File: 45 KB, 599x503, tumblr_na9p7grbXI1ri2qg4o4_1280.jpg [View same] [iqdb] [saucenao] [google]
14141804

tfw no shark mg

>> No.14141805
File: 207 KB, 750x800, 1434684315612.png [View same] [iqdb] [saucenao] [google]
14141805

>>14141797
Stop being salty anon, as all that sodium isn't healthy.

>> No.14141806
File: 189 KB, 678x531, Trying really hard not to laugh.jpg [View same] [iqdb] [saucenao] [google]
14141806

>>14141797
>Kikimoras will be known as some bitchy dominant asshole that will beat the shit out of you
Gee, I wondered how that happened.

>> No.14141809

Instead of having a maid I'd rather be a butler to a dragon.

>> No.14141812

>>14141797
I wonder who's behind this post...

>> No.14141815
File: 375 KB, 1920x1200, Fun-chameleon.jpg [View same] [iqdb] [saucenao] [google]
14141815

>>14141804
Tfw no chameleon mg gf.

>> No.14141819

>>14141809
A lewd butler?

>> No.14141820

>>14141809
I scoff at your preferences and would like to use this opportunity to remind you of the superiority of mine.

>> No.14141823

>>14141809
I'd rather be a butler to a monstergirl that is not shit.

>> No.14141825

>>14141809

I'd rather have neither and just be a functional adult who can look after himself.

>> No.14141826

>>14141819

No, I am not worthy of such a strong, beautiful and powerful creature.

At least that's what I think, I don't catch on that a dragon only lets a very special person polish her gold.

>> No.14141827

>>14141815
There is though. She was just forgotten.

>> No.14141828

I'd rather have a Dragon maid, but that's not allowed here along with anything else that's fun,

>> No.14141832

>>14141809
Instead of saying you want to be a butler to a monstergirl that's not shit, why not state what monstergirl you'd be a butler to?

>> No.14141835

>>14141827
Cause she was made by .less

>> No.14141837

>>14141828
We already had a story about one though...

What the fuck man, why do you have to be such an incredibly bitter faggot?

>> No.14141841

>>14141828
Of course you can, what are you even talking about?

Hell, I'll have a lilim maid if I want to. They can't stop me.

>> No.14141843

>>14141835
Welp, that's understandable.

>> No.14141844
File: 124 KB, 291x470, so weird.png [View same] [iqdb] [saucenao] [google]
14141844

>>14141828
Fun?

>> No.14141847

>>14141828
You're starting to sound like a whiny bitch, Anon.

>> No.14141850

>>14141828
Only a legitimate autistic person would tell you that you can't have a dragon as a maid, which I really fucking hope do not visit these threads, because our quality's been steadily dropping since we got here.

>> No.14141856

>>14141850
We haven't been all that bad lately, ever since bans started getting more common.

>> No.14141859

>>14141850
>Only a legitimate autistic person
What do you think the people who complain about anything that doesn't fit their head canon are?

>> No.14141862
File: 112 KB, 1920x1080, 1409546421628.jpg [View same] [iqdb] [saucenao] [google]
14141862

>>14141744
>>14141797
>>14141828

>> No.14141863

>>14141850
We have people like that here though.

>> No.14141868

>>14141862
Yeah, we know, just ignore it

>> No.14141871

>>14141862
God that entire series was garbage.

>> No.14141876

>>14141825
I'd rather be a functional adult, but also have a cute maid. Is that too much to ask?

>> No.14141879

>>14141876
That's the best combination

>> No.14141882

>>14141868
Do we? Because at this point it looks like we're just assuming.

>> No.14141883

>>14141871
Yes but muh Kurumi

>>14141876
>I'd rather be a functional adult
I read that as "I'd rather be a functional slut"

>> No.14141887

>>14141876
Not for me because paying maid salary is pointless when you can do everything yourself.

>> No.14141892
File: 994 KB, 160x240, 1439867373214.gif [View same] [iqdb] [saucenao] [google]
14141892

>>14141783
Shoggoth Removal Services, how would you like your Shoggoth removed from the premises?

>> No.14141893

>>14141883
As opposed to a non-functional slut?

>> No.14141894

Anyone have that screencap of an anon listing off all of the sub monster girls?

I need to know what I'm working with.

>> No.14141896

>>14141887
No, anon, if you can make more than what you pay your maid, it's pointless to do the maid work yourself, since you could be making even more money while the maid does maid work

>> No.14141898

>>14141887
>Paying
The best part about MG maids.

>> No.14141903

Guys, calm you tits and have a qt spider.

http://exhentai.org/g/856832/eb0a508e75/

>> No.14141905

>>14141896
>>14141898

I make enough for my own expenses, having a maid would just force me to reorganize my schedules.

>> No.14141906

>>14141896
Or I could use it for more free-time since most of the time my job sucks.

>> No.14141907

>>14141088
I'm not ready to travel the world, where do I decline? I would like to speak to my Tanuki lawyer before proceeding

>> No.14141908

>>14141892
With Forces beyond my Comprehension.
The very fabric of reality is strained in the conflict
Child born during it with have powers mortals can not comprehend, monsters will fear for their lives.
And when it's all over, when everything is said and done, I want a complementary towel.

>> No.14141918

>>14141903
>spider
>qt
Begone, SIDF.

>> No.14141919

>>14141892
You can go. Just like in maidhood, you are no longer needed.

>> No.14141920

>>14141903
>Horitomo
His art's bad anon.

>> No.14141925

>>14141919
Shots fired.

>> No.14141927

>>14141903
Cute

>> No.14141930

>>14141903

>Childhood friend spider

I like this.

>> No.14141932

>>14141908
Best I can do is our deluxe package where we have a Kiki hit her with a broom and chase her off and we dispatch our squadron of armed slavs to make sure she doesn't come back

ok an hiro, tell me how I'm "mistyping" captchas that I'm selecting images in

>> No.14141940

>>14141932
Do I still get the complementary towel?

>> No.14141941
File: 197 KB, 617x1404, 1443212564201[1].png [View same] [iqdb] [saucenao] [google]
14141941

What would native Australian monster girls be like, considering the animals native to australia and the culture of aborigines?

>> No.14141943

>>14141932
>spoiler
Yeah, I've been getting that lately too
Also got a really random warning earlier

>> No.14141944

>>14141940
It has been used by the slavs to squat upon, but yes

>> No.14141956
File: 964 KB, 1200x1696, 17b8a7cbb14f1e9630edcaaf5d1fd6ca-ed.png [View same] [iqdb] [saucenao] [google]
14141956

Lich ear play continues. Catch up here:
http://pastebin.com/Zy4hu8xG
You can't stop me from using Hexer images in place of liches.

>>14137207
>Her weight shifts suddenly, your ear exposed to the air as her cool lips move away
>The covers rustle gently as she moves, and you know, even if you can't sense, that's she's making her way to your left ear
>But even then, you still feel that sudden electric tingle, as she blows a slow, ticklish breath deep into your left ear
>It's like she's imbued some pleasure magic into the air, letting it flow as far into your head as possible
>She keeps blowing, sometimes in short breaths of near-chilling air, sometimes in long, impossibly long drafts
>They pass over the top of your ear, drifting onto your antihelix, inside the ridge, before lowering even further, hitting that sweet spot as your canal is stimulated
>After some time, her hand joins in on the fun, two fingertips at a time passing over your auricle in tantalising little tickles, the dull sound of ther rubbing reverberating in your skull
>She whispers your name again, like a command to bring every nerve in your body to attention
>But her breathing stops, and when she next speaks, it's from above, as she sits atop you
>"Earplay commonly involves talking?"
>"Yeah," you say, shuffling around as she sits just millimetres above your erection
>Silence
>Then: "I'm unsure of what to say."
>Oh. You blink in the darkness. Should've seen that one coming.
>You reach over, and find her hand making a dent in the mattress as she leans on it
>She opens up to your touch, lacing fingers between yours, all the way down to the knuckle, holding tightly
>"Just say whatever you want," you tell her. "Whatever comes to mind, and whatever you think might be erotic, or sound nice."
>"I see."
>After a pause, she shifts her weight back down on you, and suddenly your world closes in again

>> No.14141958

>>14141903
Why do people insist on treating spider legs like human legs? I want carapace, not shoes and socks.

>> No.14141966

>>14141944
Well then I can handle this myself.

>> No.14141968

>You'll never be the villain of MGC, who is always making and failing plans to stop humans and monstergirls from getting happy endings, and is made a living example to kids that evil people don't deserve a good ending as you go back to your secret hideout to think up a new scheme

>> No.14141975

>>14139287
This is pretty sweet, thanks anon.

>> No.14141977

>>14141968

So you're just the remanent of the Order in the area?

>> No.14141979

>>14141968
>Does he get fought off by the Monstrous Sentai Squad?

>> No.14141986

>>14141968
You left out the part where you intentionally design and implement your plans to fail so that human-monstergirl couples are be brought closer together resulting in a guaranteed happy ending for the couple.

>> No.14141996

>>14141977
One of the few strays that didn't get the memo that the war is over.

>>14141979
Yes.

>>14141986
That was the plan all along. Making everyone happy at the cost of your reputation.

>> No.14142002

>>14141986

>My story was never going to be one with a happy ending but that doesn't mean I can't help other people find their happy ending

A true hero.

>> No.14142005

>>14141782
>>14141798
>>14141801
>TFW no Shoggoth stories

Best maid where.

>> No.14142027

>>14141956
>Spoiler
Wouldn't dream of it.

Please, do go on!

>> No.14142036
File: 487 KB, 1500x2131, 52050804_p0.jpg [View same] [iqdb] [saucenao] [google]
14142036

Brush brush

>> No.14142041

http://i.imgur.com/8UsBlfN.png
This site's algorithm is kind of fucked up.

>> No.14142044

>>14142036
That Wendigo has no neck.

>> No.14142045

>>14142036
Please no

>> No.14142047

>>14142036
This is some deviant art tier shit

>> No.14142048
File: 405 KB, 737x1200, Kikimora_L.jpg [View same] [iqdb] [saucenao] [google]
14142048

>>14142005
>form a relationship with a kiki who showed up on your doorstep
>"Well, master, now I'm your servant, what would you like me to cook for you from now on?"
>"well I'm not picky, I love almost everything, so how about you make whatever you like most?"
>"hmmm. well, what I like most is whatever master likes most. So what do you wan't me to make?"
>"I really don't care, the fact that you'll be making me food at all makes me extremely happy, no matter what it is. So please, just make whatever your favorite is."
>"my favorite is master's favorite. if master said his favorite was plain oatmeal, prepared with water, that'd be my favorite too, for example."
>"look, I know you must have a food that YOU like above all others. your personal favorite. the food you love most. make that."
>"that food would be whatever master's favorite would be, I don't understand your question."
>this repeats ad infintium until you finally cave

>> No.14142053

>>14142041
Hah

Where's this from?

>> No.14142055

>>14142047
Pixiv is basically the Japanese deviantart

>> No.14142059

>>14142048
Oh my god, this would totally happen with me
I am not worthy of a kiki

>> No.14142061

>>14142005
We'll see when the poll comes around.

>> No.14142063

>>14142055
Pixiv at least has a good part.

>> No.14142064

>>14142055
Except you need Premium(TM) paid accounts to do even basic stuff like searching by tags, popularity, etc.

>> No.14142065

>>14142048
Just tell her your favorite food is the same as hers.

There, you have a broken kikimora. Congratulations.

>> No.14142066

>>14142048
>My favorite food is you!
>Ahn~

>> No.14142068

>>14142041
It uses flesh tones.

>> No.14142071

>>14142064
how much?

>> No.14142072

https://www.youtube.com/watch?v=zhM4X3cozdI

>TFW no MG version of this

>> No.14142075

>>14142071
Your lunch money, you fucking nerd.

>> No.14142080

>>14142071
Too much. Given pretty much every other art site in existence has basic search abilities for free.

Pixiv also makes you pay for other simple thing other sites have. Like status update alerts on artists you follow, bookmark organization, avatars with .gifs. You know, simple stuff that has been around and free since, like, 1995.

>> No.14142085

>>14142066
This guy fucks

>> No.14142089

>>14142080
You know what the funny part is? Pixiv has awful restrictions like that and deviantart doesn't allow R-18 content so the site with the most freedom is tumblr.

It's kind of sad when you think about it.

>> No.14142096

>>14139021
This is so adorable

>> No.14142111

>>14141956
My browser crashed right before I posted this next part. I had to rewrite it. I am extremely angry about this.

>You start in suprise as, in the next moment, the bed seems to suddenly fall away from you
>Your bedcovers dissapear in the next second, but you don't feel yourself drop
>Instead, you remain exactly as you were before, only with the lich's refreshingly cold, entirely naked body sitting atop yours
>Maybe you're suspended on a bed of magic, maybe you're floating feet above your own, or maybe the lich had transported the two of you to her own, empty dimension entirely
>You don't know, nor do you care
>All you care about is the feeling of her body, luxuriously and gracefully slide over yours, until she hugs your right side, legs wrapped around your waist, hand pinned by her pelvis
>"In that case," her dulcet monotone begins, inches from your ear. "I hope this satisfies"
>Every "h" is a huff of air against your tender skin, every "s" a seductive hiss
>At one point, her hand finds its way to your chest
>You tense at the feel of a single fingernail, gently tracing around your pectorals, drawing slow figure-eights upon your skin
>All to distract you as she moves so closely upon your ear, her lips brush against it with every sound and movement she makes
>Not a millimetre of space seperates, and yet her voice is as soft as her own body, cuddled against you
>It only makes it more intimate when she speaks, the shivery sensations only assaulting you harder
>"It's been a long time since I ever spoke so much, in such a short span."
>'God, please don't stop now' you think, urging her onwards
>"Aural stimulation." She draws it out so subtly, almost as if she doesn't even intend to. Stim-u-la-tion.
>"Ways to give you pleasure I didn't even know existed." Her lips are a feather touch against your skin, an erotic herald to the heavenly sounds she's filling your mind with, making your member twitch to every little shiver she allows you

>> No.14142119
File: 102 KB, 1200x1500, 1442949974342.jpg [View same] [iqdb] [saucenao] [google]
14142119

>>14142089
I remember this one tumblr image of a landwhale and Mari in a weird pseudo-chibi art style. Was fucking weird.

>> No.14142123

>>14139021
>Humans take care of crippled monstergirls
>Monstergirls would just abuse crippled humans

Huh.

>> No.14142125

>>14142089
But Tumblr doesn't allow full resolution images like DA and Pixiv.

>> No.14142126

>>14142119
I remember that.

>> No.14142128

>>14142123
>Monstergirls would just abuse crippled humans
From what crevice of your asshole did you pull this from?

>> No.14142130

>>14142064
What? I search shit all day long and don't pay anything.

>> No.14142133

>>14142128
About every instance asked here about this kind of situation ends up with alot of "he gets raped" replies.

>> No.14142134

>>14142053
http://exhentai.org/g/775511/f206f44fd0/

>> No.14142135
File: 641 KB, 2864x2365, 6f6fa27eb52d9e5c89c14aad4534d732.jpg [View same] [iqdb] [saucenao] [google]
14142135

>>14139687
Agreed.

>> No.14142140

>>14142125
Yeah that's another problem, there's also twitter but good luck searching through that and they've been known to delete H artist's accounts before.

Also at the risk of derailing the thread, I went to tumblr to see if any art had been uploaded recently and found something truly horrifying.
http://moldykins.tumblr.com/post/129508793707/ah-jeez-jabberwock-why-do-you-get-two-weiners-also
I almost spat out my beer.

>> No.14142141

>>14142133
Wait, you actually take those seriously?

>> No.14142145

>>14142141
Since nobody cared to give an actual answer, what else is there to consider, especially in a place like this?

>> No.14142148

>>14142140
The face is the worst part.

>> No.14142149
File: 1.13 MB, 500x375, Stealth is an option.gif [View same] [iqdb] [saucenao] [google]
14142149

>>14142140
I can not unsee

>> No.14142150
File: 164 KB, 1024x768, 1442097171807.png [View same] [iqdb] [saucenao] [google]
14142150

>>14142140
Why hasn't this SJW abomination killed itself yet?

>> No.14142156

>>14142148
>those fucking man shoulders
That Jabberwock literally looks like a gay transvestite in cosplay gear.
Even its boobs look out of place and misshapen.

>> No.14142158

>>14142140
Why do they always need to put a penis on the best girls? First hellhound now this...

>> No.14142160

Spider girls are really creepy and gross, what would be the best way to keep them away from me?

>> No.14142161
File: 358 KB, 557x581, 8.1.png [View same] [iqdb] [saucenao] [google]
14142161

>>14142140
Of all the Monster Girls in the world

Of all 175 MGE ones

Why is it the one I like that continually gets horrific porn images drawn of her

I just don't know anymore

>> No.14142165

>>14142111
>"You know how long I've been alive." She unwraps her other arm from yours, and its touch dissapears into the darkness
>Before her hand descends upon her head
>You melt like butter under her touch almost instantly, the way she strokes your hair and massages your scalp, so deeply and gently
>And still she continues, laying pleasure of three kinds entirely upon your chest, ear and head. "Yet," the lich whispers, "There's few times I've been this nervous."
>Her voice betrays no hint of it, but it makes sense. An entirely new way of giving pleasure, using one's voice, a tool she almost never employs
>"You're doing perfectly," you say, toes curling, erection begining to cross territory into the "raging" category
>"I'm glad," she replies, tone unchanging. "Because..." She pauses, drawing out the word and adding inflection to it as she's never done before.
>"I..." The word settles upon your mind like a silk shroud, wrapping it up and staying there, as a curious tingling begins at the base of your shaft
>"Love..." She takes her time, teasing you, withholding each letter as long as she can, while that pleasant warm pressure begins to climb up your member
>"You." The third silk shroud falls, and your thoughts with it, as if she's cast some hypnotic spell on you

>> No.14142166
File: 879 KB, 1666x1666, 52398371_p0.png [View same] [iqdb] [saucenao] [google]
14142166

>>14142156
It's like he's trying to be 'counter' to accepted and held ideas of femininity and beauty, but he has no idea what the fuck he's doing so he just draws guys with breasts.

>> No.14142167

>>14142161
DON'T FUCKING SAVE THAT PICTURE JABBERWOCK GUY

FOR ALL THAT'S HOLY

>> No.14142169

>>14142158
>Cheshire
>Hellhound
>Jabberwock
Next they'll make a futa Yeti the way things are going, that'll be the day I end up gouging my eyes out.

>> No.14142171

>>14142145
>in a place like this
What kind of place is this?

>> No.14142175

>>14142161
>That file name
I was thinking of you when I posted it, stay strong and don't save it. Not even in that folder for awful images.

>> No.14142177

>>14142140
Delete this.

>> No.14142178
File: 2.46 MB, 2480x3508, 1430771396835.jpg [View same] [iqdb] [saucenao] [google]
14142178

>>14142161
You will get your reprieve one day, you poor bastard.

>> No.14142181

>>14141735
>I have a feeling I know who to blame for it
Yeah, Stephen king.

>> No.14142184

>>14142160
All spiders deserve love. You just need to give them a chance.

>> No.14142185

>>14142140
>No longer content with simply uggifying monster girls, he's started slapping dicks on them as well.

Is this some sort of punishment?

>> No.14142187
File: 1.56 MB, 983x1073, 184.png [View same] [iqdb] [saucenao] [google]
14142187

>>14142169
>futa Yeti

Don't even fucking joke about that shit, I'll buy the nuke circulating in the black market and eviscerate whoever does this with it.

>> No.14142188

I want to give a jub jub cakes and sweets before moving in and serving her.

>> No.14142189

>>14142187
I don't get it
Just because someone wants a futa yeti does that make them all futa? Why get so upset?

>> No.14142191

>>14142140
GEE BILL, HOW COME YOUR MOM LETS YOU HAVE 2 WIENERS?

>> No.14142193

>>14141742
This doesn't seam realistic. Pain and having some loud bitch lecture and berate you as you wake up doesn't make you horny and rapey. It makes you angry and beaty.

>> No.14142195

>>14142188
Too bad! You get manface monstergirls with dicks!

>> No.14142196

>>14142184
I don't want to though, Spiders freak me the fuck out.

>> No.14142198

>>14142187
One nuke isn't enough.

>> No.14142199
File: 582 KB, 854x1200, MIDSUMMER NIGHT'S MOTORBOAT.jpg [View same] [iqdb] [saucenao] [google]
14142199

>Be old Knight, your hair and beard have gone a deep grey. Your face is wrinkled like weathered pages of a book, and you still carry a scar over one eye where a rogue blade blinded you
>You're walking through the woods of your childhood, the attendant giving up on you, thinking you're lost in the geriatric daydreams of your senior years
>You can still remember every lichen covered rock and twisted tree on the path, and you soon lose your way in the brambles and the thickness of the forest
>But you haven't come this way to die
>Merely to visit an old friend
>Your cloak is getting mussed and dirty from your trek into the forest, blooms popping up here and there
>You can hear the faint giggling of the fey folk
>They've made themselves harder to see, the lights dancing to and fro
>Several of them playfully surtsy to you as you smile back at them
>The darkening sky gives way to eternal spring, the warm rays of the sun touching your face and making you feel just a little bit younger
>You can see her now, the Titania sitting on her throne of vines, dressed in gossamer
>Several fawns and satyrs spot you and pause in their play, taking a knee as your legs begin to give out
>Ahh... It's been such a long journey
>The Titania walks forward, gracefully
>Flowers grow and wilt in her stride as she places one hand on your weathered face, noting the sigil of ornate wings on your breast
>Only she'd know the meaning of it
"Welcome home, Oberon."
>Your skin is becoming tighter and firmer, your hair regaining some of it its youthful shine as you take her hand in your gloved one, feeling at peace, sighing wistfully
"I'm home... My Titania."
>She kisses you on the forehead, letting you lay your head on her lap as sleep takes you
>She's stroking your hair, as she used to do when you were and now are just a young boy
"Dream me a song of dragons, my beloved Oberon."
"Then tell me your story."

>> No.14142203

>>14142195
Never!
I'm going to feed her sweet pies, cup cakes, and ice cream before serving her right and proper with a smile.

>> No.14142210
File: 193 KB, 1280x824, 1394893538618.jpg [View same] [iqdb] [saucenao] [google]
14142210

What is the ideal house/area you want to live with your waifu in?

>> No.14142215 [SPOILER] 
File: 548 KB, 1211x758, 1443222580160.jpg [View same] [iqdb] [saucenao] [google]
14142215

>>14142191
Squid girl wieners

>> No.14142217
File: 71 KB, 640x426, blue-red-pill.jpg [View same] [iqdb] [saucenao] [google]
14142217

The red pill will teleport you to KC's world and you have the chance to meet your favorite monstergirl, The blue pill would bring her to our reality, which one would you take?

>> No.14142221

>>14142217
Red Pill

>> No.14142223

>>14142217
Blu

>> No.14142224

>>14142217
Blue pill sounds awful. Why?

>> No.14142226

>>14142217
Red. Let's fucking do this shit. If it's blue, there's no guarantee she'll even like me anyway. At least with Red I can always find one eventually.

>> No.14142229

>>14142217
Red.

>> No.14142230

>>14142217
>Living in a world without the glorious sounds of the 20th century and beyond
I'm afraid I just blue myself.

>> No.14142234

>>14142230
Are you the same guy who said monstergirls can improve music because it's already perfect?

>> No.14142236

>>14142224
Because I like the modern world in which I live and wouldn't be willing to go into the equivalent of a medieval shithole fraught with actual mythical beings that roam around en masse and pose a real threat.

>> No.14142238

>>14142234
can't*

>> No.14142239

>>14142217
Red. Taking her to our world will probably get her shipped off to some facility to be a test subject for life.

>> No.14142241

>>14142234
Yes. I am very impressed/a little freaked out.

>> No.14142243

>>14142210
Since my waifu's an Ushi-Oni and she prefers caves I'd like to have a multi layered home built into the base of a mountain with all the basic utilities.
>Ground floor consists of a lobby, kitchen dining room and a guest area
>Next floor contains rooms for entertainment areas, a gym with equipment suited to her too and area for sparing
>Top floor contains a king sized, Ushi friendly bed, extra large shower and a bathroom
Anything else would be unnecessary.

>> No.14142250

>>14142217
Red.

>> No.14142249

>>14142241
I just remember things. I'm not stalker-kun by the way.

Do you work with music or just like listening to it alot?

>> No.14142251

>>14142217
Red, this world is shit so I might as well take a gamble with a different one.

>> No.14142252

>>14142217
I think i would have to say blue

>> No.14142254

>>14142239
>tfw your waifu could easily blend into human society

>> No.14142264
File: 85 KB, 770x521, f427c530b499385e6a76914bf879a2c67606662b.jpg [View same] [iqdb] [saucenao] [google]
14142264

>>14142210
Pic related yes she's a vampire

>>14142217
Red obviously

>> No.14142274

>>14142166
Ostensibly, that's what they're claiming to do.

But frankly their idea of it is just "Draw something fugly and call anyone who doesn't like it cisscum sexists", which is of course, fucking stupid. But that's the "tumblrite" community for you.

>> No.14142275

>>14142249
I love listening to it. I'd sooner go through a lifetime without sex than a day without music.

>> No.14142281

>>14142274
I wouldn't besmirch an entire website based on a few mouthy people. There's lots of great porn and shit on there.

>> No.14142282
File: 239 KB, 424x600, 1430432069685.jpg [View same] [iqdb] [saucenao] [google]
14142282

>" One jump, ahead of the Werecat! "
>" One swing, ahead of the claw! "
>" I steal, only what I can't afford! That's everything! "

>> No.14142283
File: 21 KB, 514x301, Commission Chart.png [View same] [iqdb] [saucenao] [google]
14142283

>>14142167
>>14142175
I'm not, I think that was my breaking point.

>>14142178
Hopefully so. At least I plan on getting a load of new artwork for her, it's the least she deserves after that image.

I've been meaning to ask this for a while, but does anyone have suggestions for a Monster Girl artist currently taking commissions? I've exhausted all the options I know and I'm still one artist short. If you guys have any suggestions for artists, that would be helpful.

>> No.14142291

>>14142282
She can just come and live with me.
I'll give her all the cheese she can eat.

Along with much that she can't.

>> No.14142292

>>14142199
Huh

>> No.14142293

>>14142264
Sweet, sweet +3 gold, +2 culture, and +1 happiness.

>> No.14142298
File: 154 KB, 890x720, 1439402649508.jpg [View same] [iqdb] [saucenao] [google]
14142298

>>14142210

>> No.14142300

>>14142217
I got a Better one.
Red Pill: You go to whatever world you want, but become Madara Copypasta tier powerful, not even the strongest Demon Lords dare to even approach you. Everyone is afraid of you because you could kill them in one blow.
Blue Pill: You get your monster girl waifu but she's completely beta, to afraid to do anything other than just being within 5 feet of you

>> No.14142304

>>14142282
Street rat!

>> No.14142305

>>14142293
*per castle

>> No.14142306

>>14142282
She's getting shot.

>> No.14142311

>>14142217
>A literal Hugbox where nothing bad ever happens
>Or this shitty fucking reality full of assholes
Gee, I wonder.
>>14142210
>Sandwurm
Waifu is house/area. Set her worm half to autopilot and make sweet love as she burrows through tectonic plates, popping up in random parts of the world every now and then.

>> No.14142312
File: 1.07 MB, 992x1403, 1442938531119.jpg [View same] [iqdb] [saucenao] [google]
14142312

>>14142283
Have you ever considered Barbariank?
I've never commissioned him before, but I have received 2 deliveries from him in the /v/ drawthreads.

>> No.14142317

>>14142300
It's shit.

>> No.14142318

>>14142210
An Island full of stupid animals that could be extinct if it weren't for the fact that the Island is fucking easy to live on but in the middle of nowhere. A house in the inside of the Island, over looking all the stupid animals who come gawking at you with their dull eyes filled with lame curiosity.

>> No.14142319

>>14142306
A cumshot?

>> No.14142320

>>14142236
yeah but magic pretty much replaces technology so convenience is still the same.

>> No.14142324

>>14142217
My waifu wouldn't survive in reality. So red pill I suppose.

>> No.14142325

>>14142319
No, rubber bullet.

>> No.14142326

>>14142320
Magic doesn't replace my favorite forms of entertainment.

>> No.14142333

>>14142264
>Vampire waifu builds a mountain castle high in the alps
>Every time you mention winter, she dismisses your concerns as silly
>December comes
>It's too cold, there's too much snow and you're too far from civilization to restock your supplies
>She's forced to hire Yetis to ferry food and supplies up the mountain to the castle
>"T-This was the plan all along, I know what I'm doing! Still, m-maybe we'll build a second castle. You know, just as a vacation home."

>> No.14142334

>>14142326
like?

>> No.14142338

>>14142243

> His waifu is an Ushi Oni, yet he still makes the day 1 mistake of having the bedroom on the top floor

>> No.14142339

>>14142334
Television, gaming, the existence of the internet.

>> No.14142340

>>14141828
Just don't invite black harpy neighbors in.

>> No.14142341

>>14142312
http://barbariank.deviantart.com/

This guy? I never heard of him before, but his style seems nice, I'll try contacting him, thanks Anon!

>> No.14142344

>>14142210
As a Canadian you pretty much posted it. Some comfy-as-fuck winter cabin styled house out innawood or innamountains.

>> No.14142345

>>14142283

Look at the listing on the wordpress

>> No.14142347

>>14142341
I only recently found out that he's the one that did that MGE Lich cowgirl POV pic.

>> No.14142349

>>14142210
A quaint, affordable apartment. Doesn't need to be spacious. Two bedrooms, a bathroom, and a living room/dining area. Kitchen must be separate. Definitely on the second floor or higher with a balcony. We'd stay in there for a few years, get our careers down and grow comfy with one another, then we'd get married and look for a good mortgage on a house. I'd love for it to be in my hometown, next to the river. It's beautiful in the morning when the mist rises up and crawls up onto the lawn. And in the winter the ice is thick enough to walk across, although I'd have to watch out for ice fishers and their holes.

>> No.14142353

>>14142210
A nice cottage, built into the mountainside, which actually extends deep into the mountain itself as a magnificent underground manor.

>>14142217
Red.

>> No.14142357
File: 85 KB, 1920x1080, 1344806226165.jpg [View same] [iqdb] [saucenao] [google]
14142357

>>14142325
Is it truly worth the trouble?

>> No.14142360

>>14142357
You fucking bet it would be.

>> No.14142367

>>14142281
I know anon. I follow numerous artists on tumblr, and of course, there are all the marvelous porn rebloggers.

Thus when I say "tumblrite" community, I'm referring to the particular caste of SJW Landwhale and Apologists that give the website it's horridly negative reputation.

>> No.14142370

>>14142293
One of my favourite wonders in the game for that reason.

>> No.14142385

>>14142345
>Using the wordpress or any other site
>Not just e-mailing monorus or maritan or some shit from their websites/pixiv accounts

>> No.14142394

>>14142385

> Not using a listing of drawfags which has their contact info, average price, delivery speed, and so on

k

>> No.14142410

>>14142165
>It's so hard to hold a thought, like a mist clouding your thoughts
>All you can focus on are the sensations, the way her words imprint on your mind
>And of course, the little, gel-like bubble of magic growing and seeping along every inch of your hot, sensitive shaft
>It pulses with every movement and sound the lich makes, a spell tied intimately to her own being
>"That's why I'll make this as pleasurable as possible." Her voice takes on an odd, captivating rhythm as she continues
>Still as emotionless and collected on the surface as always, but surging beneath with hundreds of years of lust and love to give
>"Are you enjoying it?" Even if you could see, you know her face wouldn't betray a hint of the devious smirk painted on her mind
>"My voice is your pleasure," she says, some magical power subtly slipping into her voice, enhancing every aspect of it
>You've had her pleasure your soul before, but her voice now is like an angel's chorus, vibrating against it directly, more beautiful than any earthly music
>"When I say it, you will cum." It's a command, an incantation she's casting upon you, to bring your attention back down to your crotch
>The bubble feels hot and alive, a sharp contrast to her body, pressed lovingly against yours
>It milks and builds up a slow pleasure, deeper and more fulfilling than even the physical sensation of sex
>And as it builds up, the lich begins her blissful assault on you in earnest

>> No.14142412

>>14142340
Niebelfader pls.

>> No.14142415

>>14142410
Keep going.

>> No.14142434

>>14142412
>story just hit the 3k hit mark
>2x as many as his best work
inflammatory > qualitative

>> No.14142438
File: 73 KB, 550x328, threedifferentreactions.png [View same] [iqdb] [saucenao] [google]
14142438

>>14140346

>> No.14142447

>>14142438
gr8

>> No.14142448

Is .less still doing commissions?

How do I contact him for one?

>> No.14142451

>>14142215
Marie has excellent taste in summer food.

>> No.14142463

>>14142438
I want to eat that burger.
I don't care what toll it'll take on the bottom portion of my body.

>> No.14142465

>>14140471
Never.

>> No.14142471

>>14142438
>Wendigo having a meltdown
heh

>> No.14142476

>>14140761
>that dairy breed

im not a horsefucker. I'm NOT a horsefucker! I'M NOT A HORSEFUCKER!!!

>> No.14142478
File: 174 KB, 600x502, 1437924956993.png [View same] [iqdb] [saucenao] [google]
14142478

>>14142463
>>14142463
I had a burger once with cheyenne, paprika, thyme, oregano, Frank's Red Hot Sauce, Pepper Jack Cheese and cooked to Medium Rare.

It was the single most painful experience I've ever put my rectum through. I felt like I was a fucking dog passing by razor blades and shitting molten lava. I'd still do it again.

>> No.14142479

>>14142394
Go away ELH

>> No.14142482

>>14142434
Well, it's been updated so many second watches.
Plus controversial/heavily emotional stuff usually gets a lot of attention.

>> No.14142484 [SPOILER] 
File: 29 KB, 291x200, 1443226685448.jpg [View same] [iqdb] [saucenao] [google]
14142484

>>14142476
Just accept it, anon. It'll be easier that way.

>> No.14142486

>>14140826
Why?

>> No.14142487

>>14140862
Hnnngh

>> No.14142492

>>14142478
Damn, and the spiciest I'll ever go is cayenne pepper.

>> No.14142496

>>14142438
>Yeti
What Is This Expression Trying to Convey?

>> No.14142500

>>14142496
>Shit nigga, dis sum gud fukin burger

>> No.14142502

>>14142478
That doesn't even sound that bad.

>> No.14142506

>>14142502
Oh it was fucking delicious with a nice oil can of Foster's since I'm too poor to get the good beer from Wegmans. It's the aftermath when you have to shit it all out.

>>14142479
Fuck off Shoggocks

>> No.14142511

>>14142283
Jesus man, wish I had the money to do something like this, or at least the creativity to even think up that many different picture ideas.

>> No.14142521

>>14141647
>not raping her shit right then and there

>> No.14142523

>>14142506
I meant the aftermath. It cant be worse than the time I ate a ghost pepper thinking I was calling someone's bluff.

>> No.14142528

>>14142521
>Raping a scared child who doesn't know what she's doing

Fucking subhuman filth.

>> No.14142533

>>14142478
That doesn't sound too bad. I should give that a go I eat a lot of hot things anyway so my body is mostly used to it. I still shit fire if I overdo it, though.

>> No.14142534

>>14142523
>Eating a ghost pepper

I feel for you. I really do.

But then again if I eat anything greasy at all the shit goes through me like eucalyptus through a Koala

>> No.14142536
File: 546 KB, 1470x855, Sun scribbles.png [View same] [iqdb] [saucenao] [google]
14142536

Something, something praise the sun.

>> No.14142537

>>14141892
WITH VIOLENCE, FIRE AND STEEL POKEY THINGS

>> No.14142544

>>14142283
You are one organized motherfucker.

>Swimsuit Jabberwock by Monorus
>Grillmaster Jabberwock by .less
>Sprintime Schoolgirl Jabberwock by Butter-T

I look forward to all of these.

>> No.14142545

>>14142496
It's a pretty good burger

>> No.14142547

>>14142141
Do you not?

>> No.14142550

I want to find a stranger in the alps!

>> No.14142551

>>14142536
Hathors titties need to be bigger.
Also, nice work nameless drawfriend.

>> No.14142553

>>14142536
Nice.

>> No.14142555

>>14142533
>Shit fire if you overdo it

We need to test something with MGE physics.

Putting Lava Golem jelly on a burger and then some creme ala Salamander for that extra kick

>> No.14142556

>>14142555
>creme ala Salamander
Salamander milk?

>> No.14142560

>>14142523
>Ghost Pepper
Stop being a bitch
Eat a Carolina Reaper or Chocolate Bhutla.

>> No.14142561

>wurm space program
>they want to do a manned mission to the sun but its too hot
>so they go at night instead

>> No.14142564

>>14142199
Gay

>> No.14142568

>>14142560
Y'know at some point it seems like people aren't even eating peppers for the love of spicy food and are just doing it for bragging rights.

>> No.14142569

>>14142438
Cute, I like the Yuki-onna glaring at the Yeti for not feeling the spice

>>14142496
I didn't know Jaden Smith liked MGs

>> No.14142577

>>14142568
Dude of fucking course.
When hasn't humanity done anything for bragging rights?

>> No.14142581

>>14142568
Its like a Vindaloo. No one eats those because they like them, you can't taste any of the curry's flavours at that point, so all you get is intense heat. Its mostly used to look tough after several beers.

>> No.14142583

>>14142568
That because at some point the heat stops being tasty and enjoyable and just becomes painful, but life is one giant pissing contest against anyone else willing to compete, so people press on regardless.

>> No.14142585
File: 588 KB, 1024x1024, 1441602554192.png [View same] [iqdb] [saucenao] [google]
14142585

HONK HONK

>> No.14142587

>>14142569
>Cute, I like the Yuki-onna glaring at the Yeti for not feeling the spice

Doesn't look like glaring to me. I thought it was more her eyes are like that because they're watering up on account of the spiciness. Also eyebrows aren't crossed like someone who is angry.

>> No.14142592

>>14142585
>You'll never throw a pie at a Ushi's face

>> No.14142593

>>14142550
What.

>> No.14142594

>>14142585
Her claws are so piddly looking.

>> No.14142595

>>14142585
I find this image depressing for some reason

>> No.14142599

>>14142550
YOU SEE THIS LARRY

>> No.14142601

>Tell your Shoggoth maidwife that she is your everything
>"Master, that's so wonderful. I love you so much."
>"No, seriously, you're everything. How the fuck are you connected to the internet?"

>> No.14142605

>>14142550
The Big Lebowski redone by monster girls, with an Alp as Donnie
>I'm Shomer Sabbath Alpie, that means I don't work, I don't drive a car, I don't fucking ride in a car, I don't handle money, I don't turn on the oven, and I sure as shit DON'T FUCKING RAPE
>SHOMER SABBATH

>> No.14142608

>>14142528
She knew enough to act haughty and use the mating call of the CC. She's getting on this dick and there's fuck all that will stop me!

>> No.14142609

>>14142595
Why? Judging at first glance, it looks like she's a single Ushi who's been invited to a party and has no one to talk to, and to make matters worse, gets sprayed with funny spray by a clown. Is that it?

>> No.14142610

>>14142601
I guffawed.

>> No.14142611

>>14142608
>there's fuck all that will stop me!

Of course there is. Telling you these simple words will stop you dead in your tracks:

You can't rape her because she's not real

Git fukt skrub.

>> No.14142612

>>14142587
I guess you're right, she should share with the Wendigo who's overheating

>> No.14142618

>>14142217
>red
>find waifus
>never tell them where I come from
>dick around this world to see what monstergirls are really like
>keep quiet about a planet full of men if they're shit, research dimensional magic magic if I find them acceptable and cleanse this world in mamono mana and pussy stink

It would be glorious either way

>> No.14142622
File: 439 KB, 1200x849, clip (2015-09-25 at 07.20.54).jpg [View same] [iqdb] [saucenao] [google]
14142622

>>14142605
The Dude is a dry-delivery vaguely-snarky mantis. Donny is a dragon with some meat on her bones.
>He came on my rug, man.
>It really tied the room together.

>> No.14142623

>>14142611
>he doesn't know how to ankou

HAHAHAHAHAH! GET REKT!

>> No.14142626

>>14142622
>donny
*Walter
fuck

>> No.14142630

Do we call this place /mgt/? I forget.

>> No.14142632

>>14142630
It alternates from /mgt/ to /mgg/
Depends on who you ask

>> No.14142633

>>14142630
Yes, we do. Try not to use /mgg/ since it overlaps with /metal gear general/

>> No.14142634

>>14142630
Yeah, we're /mgt/.

>> No.14142636

>>14142630
No, Anon. We call this place hell.

>> No.14142640

>>14142636
This is fine.

>> No.14142641

>>14142630
Yeah, Metal Gear thread.

>> No.14142649

>>14142633
>>14142641
I don't know what to believe

>> No.14142650

>>14142641
>>14142640

Why are we still STANDING HERE? Just to suffer?

>> No.14142654
File: 38 KB, 640x364, 1443223506425.jpg [View same] [iqdb] [saucenao] [google]
14142654

>tfw no Skeleton MG will walk up to you and ask you to see your underwear

>> No.14142656

>>14142650
Pfft, took you long enough. I REALIZED this a long time ago

>> No.14142658

>>14142649
The Metal Gear General uses MGG, not MGT. See:

>>117229546
>>117246235

>> No.14142660

>>14142656
Must've been rough for you to have known such saddening truth for so long. If only YOU WERE JUST LIKE ME and didn't know it until now, your suffering would've been at least postponed.

>> No.14142671

>>14142660
Aye. But alas, it's too late now
Perhaps at some point I was TRYING TO MAKE HISTORY by discovering the purpose of it all, but all I discovered was the truth, and the truth hurts

>> No.14142678

>>14142410
>Softness and wetness wraps around your right ear, starting at your lobe, and curling up and around in a in a slow crescent
>She sucks and kisses enough to make a succumbs blush, working with such fervour that even a few involuntary moans quiver into your ears
>It's enough to make you think she's become an entirely separate person, but when she speaks, she remains just as calm as always
>It might even be unsettling, if you weren't so deeply enraptured by her trancelike hold over you
>"Getting tired?"
>You don't answer; it's like your entire body is encased in some intangible variant of the jelly orb holding your shaft and suspending your balls in its buoyant embrace
>Her words have wormed their way into your brain, seeping your strength and replacing it with heavenly surrender
>Even with her smaller body, the way she wraps against your side feels as if she's cradling you in her floating void
>"Yes, relax. Sink into the feeling. Let it..." You start as her next words slide not into your right ear, but your left. "Surround you."
>"How-" you begin, already realising that she's magically projecting her voice into your unattended ear
>"Sssshhhhh..." the lich coos, the sound slipping and seeping like an audible ambrosia, igniting tingles and shivers all the way down your spine
>It's more like a breeze of wind than a human sound, as soothing as lying down in a quiet forest, her voice like the rustling of leaves
>"Let my magic work its will. Sink deeper, deeper."
>Every syllable is an emphasis on the pumping at your crotch, and you feel the liquid heat within you begin to surge, expanding like a physical force
>Her kissing, her sucking, and her cold, wet tongue teasing as deep into you canal as far as she can manage... It's like for every second spent as the quiet, collected undead, another part of her's been building up constantly, waiting to be unleashed upon you

>> No.14142681

>>14142671
If only we knew when it all went so wrong, these threads would've been a little better. BUT WHO'S TO JUDGE anyone here? Everyone's guilty.

>> No.14142693

>>14142681
Ain't it the truth. Everyone's a guilty party here that they can't tell THE RIGHT FROM WRONG
A sad truth indeed

>> No.14142707

>>14142412
So can some one explain to me the dragon NTR? I don't want to read it, but I'm curious. Dragon falls > Turns into female lizard > listens to any man who tells her to spread her legs

Is this the course of events?

>> No.14142714

>>14142693
We shouldn't have fallen so far. We shouldn't be so vunerable WHEN OUR GUARD IS DOWN as we are, turning hostile at each other over fetish wars, even moreso than /v/ discussing videogames.

In this regard, I THINK WE'LL BOTH AGREE

>> No.14142718

>>14142707
Nope, it's:
Dragon falls, becomes betamax lizard > bimbo Black Harpies come in and molest her > bimbo Harpies then rape her husband and get impregnated by him while the betamax Dragon watches > the bimbo Harpies take control of the Dragons hoard, while the Dragon and her daughter get the shit-end of the stick and have to wear rags

>> No.14142719

Would you give a wounded paladin who just tried to kill you and your waifu medical attention, or leave him to die?

If you save him, how do you take care of him until/after he recovers?

>> No.14142721

>>14142714
Indeed. The one thing that I have learned, which I hope everyone has learned about these threads is that VIOLENCE BREEDS VIOLENCE
BUT IN THE END IT HAS TO BE THIS WAY
I think we should stop

>> No.14142722

>>14142719
He goes to the matango pit

>> No.14142723

>>14142719
does he turn into an alp if I do?

>> No.14142724

>>14142707
No, -she- gets NTR'd by two invading black harpies who overpower her man and convince her into accepting it since she's now a dependent indecisive coward.

The husband later becomes a perma-off cumpupm as the dragon works as a servant and gets denied from her daughter's recognition even.

>> No.14142725

>>14142718

Why didn't the guy just order the dragon to light the harpies on fire?

>> No.14142726

>>14142719
I chuck the faggot off of a very high cliff.

>> No.14142727

>>14142723
Was he gay? Gay for you?

>> No.14142731

>>14142719
But I don't have a waifu.

>> No.14142735

>>14142722
>matango pit
is that a thing?

>> No.14142737

>>14142719
Help him. I may fight to defend my waifu, but I'm not cruel
Let him stay and recover, because hell I'm not sending him out there while his wounds are healing and he opens them back up. Like I said, not cruel
Perhaps show him that not all monsters are bad

>> No.14142738

>>14142719
I abandon him naked on a mountain. The Yetis demand a sacrifice.

>> No.14142740

>>14142721
Yeah, we should.

THE SIIIIIIIINS NEVER DIE

>> No.14142741

>>14142719
I try to nurse him back to health, all the while showing him that me and my waifu aren't evil despite her appearances.
If he starts acting up while trying to give him medical attention, I stick my finger in his wound to get him to settle down and accept my care.

If he tries to kill us again, though, he's not getting a third chance.

>> No.14142743
File: 53 KB, 592x286, neko.jpg [View same] [iqdb] [saucenao] [google]
14142743

What is your opinion on monsters cosplaying as different monsters?

>> No.14142744

>>14142718
>>14142724
Oh. So it was the dragon who got NTR'd not the guy. I just knew that it involved NTR and retarded interpretations of the profile.

>> No.14142745

>>14142738
That might actually kill him before they find him.

>> No.14142746
File: 121 KB, 666x568, 1439771838874.png [View same] [iqdb] [saucenao] [google]
14142746

>>14142738

>> No.14142748

>>14142737
>>14142741
And do you just let him go when he recovers?

>>14142745
Fine. He gets his clothes, some wood, but no sword.

>> No.14142752

>>14142743
I'm fine with it. Slimes do it all the time, Dopples do it all the time, etc.

>> No.14142753

>>14142719
I killl him and raise his skeleton back up as a waifu.

>> No.14142754

>>14142746
That... that's amazing. I hop this drawfag never leaves.

>> No.14142755

>>14142725
He does tell her to torch them, but the Dragon is too chickenshit to do it after some manipulation from the Harpies.

>> No.14142757

>>14142748
Yes? What, you think I'd pull a Stephen King novel which name escapes me and break his legs?
Once he's done recovering he's free to go. I'm not cruel

>> No.14142758

>>14142743
If the alp waifu insists on using polymorph that way then I'm going to demand some roleplay sex.

>> No.14142760

Would demonic energy be able to change someone's accent?

>> No.14142761
File: 290 KB, 1000x1000, kiki.png [View same] [iqdb] [saucenao] [google]
14142761

I don't know why I'm making this, what should she be saying in the speech bubble?

I was thinking something along the lines of "what is this...FILTH...M-Master?!?!"

I also like the idea of a kiki shit-posting but have no clue what she'd say.

>> No.14142763

>>14142755

That's just fucking stupid.

Come to think of it the profile says that dragons turn into "female lizards" but aren't lizardgirls able and willing to defend their love with blood an iron?

>> No.14142764

>>14142757
No, I expected something along the lines of introducing him (unwilling or not) to your waifus sister or something.

>> No.14142765

>>14142748
Yes, but the more difficult question is how without endangering anybody.
I guess the best way would be slipping him a potion the day after his wounds heal, one that makes him fall into a deep sleep, and then while he's unconscious, we take his body back to the nearest village where he'll be safe, and slip out like nobody saw us.

>> No.14142767

>>14142761
>/mtg/
>That chin

>> No.14142768

>>14142760
I hope it gives everyone Tongues and destroys the language barrier entirely.

>> No.14142769

>>14142761
>dat chin

>> No.14142770

>>14142719
No, I'd leave him, and then find the nearest single monster girl and point him to her. He's gonna get tenderly healed whether he likes it or not.

>> No.14142771

>>14142763
Thus the shitstorm when he wrote such a scenario.

>> No.14142772

That shitty story is why sub Dragons should be killed off immediately.

>> No.14142775

>>14142719
Depends. He looks like a man with his brain intact and reasonable - we'll help him (cautiously). That should get enough of the point for him.

ISIS-style dense motherfucker or actual murder with blood on his hands would likely have to get 6 feet down, either way. It's a war on extermination after all, and it's not something too hard to execute only by them.

>>14142744
Nah. It'd never even be mentioned then; traditional NTR would get Niebel become the next Burning Scarecrow of Hate of these threads as we all stand with our hands locked and sing kumbaya.
Not that it's something he'll do.

>> No.14142777

>>14142746
saitama?

>> No.14142779

>>14142764
Wha- no. No.
I'm not cruel but that doesn't mean I'm not a father

>> No.14142780

>>14142761
"I do it for free!"

>> No.14142782

>>14142761
>what should she be saying in the speech bubble
>"W-Who is this 'Shoggocks' you've been posting about lately?"

>> No.14142786
File: 25 KB, 640x480, Chin.jpg [View same] [iqdb] [saucenao] [google]
14142786

>>14142761

>> No.14142787

>>14142719
I'll help him, but have him tied to the bed. As we nurse him back to health, I'll ask my waifu to get all the Wonderland food she can get.

I always wanted a pet Alp.

>> No.14142788

>>14142782
I posted it again

>> No.14142792

>>14142763
They kinda trick her out of it by exploiting her fear of rejection, something like "he'll hate you now that you came from our cunni before, but we can still form a harem all together and you'll get your 1/3 share".

>> No.14142795

>>14142735
In the threads at least.

>> No.14142804

>>14142678
>"Just relax. Let me take care of my beloved husband." Her voice comes to you in stereo, slowly shifting from ear to ear
>And still her roaming hand plays with your chest, sometimes straying up to invoke sensation along your neck and jaw
>Electric currents dance through your hair, magical sparks playing upon the edges of her nails as they caress your head
>Every sensation builds upon the last, sending you higher and higher to ecstasy, almost unable to hold it back
>You've never been so calm, and yet so close to climax at the same time; it feels like a dream
>"You're close, aren't you?"
>"So..."
>"Very..."
>"Close." The words are thrusts upon your member, dragging you into orgasm
>And then, with one final breath of air invading both ears, you cum
>"Yes, let it all out. Slowly melt to my voice." She whispers, and you shoot out jet after jst of semen, so slowly and relaxed, you feel the swirls of white liquid might not even leave your glans, were it not for the pulsing and milking of the tight, warm bubble sucking it all out
>"Cum as much as you can, for as long as you want..."
>Her quiet words hold your body in thrall, and you can do naught but obey, humping the air and hugging her tight while she breathes and whispers, spiriting you along the crest of your dreamlike climax
>You spurt stream after stream, until the seconds melt together, and you feel yourself grow drowsy
>In the wake of such a long orgasm, the afterglow catches up, and you feel yourself drift off into oblivion, hearing the lich whisper your name, wishing you a peaceful sleep

>> No.14142805

>>14142761
Is this an edit of something, or did you draw it from scratch?

>> No.14142809

>>14142761
Is she from American Dad

>> No.14142811
File: 223 KB, 731x864, 13468560987563.jpg [View same] [iqdb] [saucenao] [google]
14142811

>>14142585
SPLAT!

>> No.14142814

I want to remind a lean sidhe that Terry Pratchett is dead

>> No.14142816

>>14142772
It was still a huge misinterpretation of the entire idea. Plus, the guy just randomly opting out after his guilty orgasm in harpies pussy was retarded, no one forbids to fucking stand for your waifu and keep struggling.
I did hate it as a sub dragon lover, mind you. Except for the intro.

>> No.14142819
File: 290 KB, 1000x1000, kiki.png [View same] [iqdb] [saucenao] [google]
14142819

How's this?

>>14142805
an edit of a sachiko pic, I'm good drawing, I just love the retarded looking original.

>> No.14142821

>>14142811
Somebody help that poor Krampus!

>> No.14142825

>>14142811
Wait a minute. That's not an Oni.

Hey, this guy's a phony!

>> No.14142827

>>14142811
Not this year, Krampus!

>> No.14142828

I dunno what kind of dragon to attempt a smut short aboot

>> No.14142830

>>14142819
Neato.

>> No.14142834

I really wish Mindflayer psychiatrists were real so I could ask one to rewrite my personality to stop being a lazy tired loser who doesn't want to do anything in his life.

Or should I consider suicide instead?

>> No.14142837

>>14142828
Purple Dragon.
>aboot
Are you a Canuck?

>> No.14142839
File: 309 KB, 1320x1116, Get Ready.png [View same] [iqdb] [saucenao] [google]
14142839

http://pastebin.com/9jMwF7th

You wanna play hide and seek with love, let me remind ya
(You're all right!)
Lovin' you're gonna miss, and the time it takes to find ya
(You're outta sight!)
Well fe fi fo fo fum,
look out baby now here I come!

Did I do her justice?

>> No.14142844

>>14142837
Ah don' know what yer talkin' aboot thar b'hay

>> No.14142850

Uh Oh! Death Knight chan and Lich Chan are going to raise over 500K dead to start a war over you!
This includes Bahamut chan's sister Tiamat and that is making HER angry!
What do you do!?

>> No.14142857

>>14142850
Be a bit confused, given I'm more used to Bahamut being dead and Tiamat being the grieving sister.

>> No.14142860

>>14142850
Why the hell are they starting a war with me?

What the fuck did I do?!

>> No.14142861

>>14142839
Aww yes, this Jinko is delicious

I envy the guy who got her in the dating service

>> No.14142863

>>14142839
>http://pastebin.com/9jMwF7th
cute

>> No.14142866

>>14142850
I gather my tamed P'Orc chieftains and their armies.

>> No.14142869 [DELETED] 
File: 293 KB, 1000x1000, kiki3.png [View same] [iqdb] [saucenao] [google]
14142869

here's my final version if anyone cares. Later, lads.

>> No.14142873

>>14142850
I muster all my magical strength and duplicate myself perfectly, so both death Knight-chan and Lich-chan can have me. And then I alp for myself, and force the two of them and my faggy clone into a harem relationship with me, uniting the two forces. Then we go bully Tiamat.

>> No.14142875

>>14142837
What the fuck is with people pushing the retarded Purple Dragon bullshit? Everybody knows they don't exist.

>> No.14142883

>>14142875
What about Puff the magic Dragon Girl who lives by the sea?

https://www.youtube.com/watch?v=80sMpIY6pBs

>> No.14142884
File: 7 KB, 1031x178, you have a deathwish motherfuckair.png [View same] [iqdb] [saucenao] [google]
14142884

>>14142875

>> No.14142892

>>14142875
>>14142884
What the hell are you doing? Oh, great. Just take it before it kills us all!

>> No.14142895

>>14142839
>muscle Jinko abjob
>them subtle hints at the Jinkos paranoia/yandereness
That was pretty damn good, anon.

>> No.14142896

>>14142884
https://www.youtube.com/watch?v=ld2nWfIap2k

>> No.14142902

>>14142884
WOCKS ARE STUPID.

I DON'T WANT TO TAKE IT

>> No.14142903

>>14142850
fuck everyone

>> No.14142908

>>14142839
Damn nice, good job.

>> No.14142909

>>14142850
>over 500K soldiers
I'm getting crusader kings flashbacks.

>> No.14142917

>>14142850
B-but I'm just some peasant who works on a farm.
Why am I so important?

>> No.14142918

>>14142917
Love is always important!

>> No.14142922
File: 783 KB, 3508x2480, 1412898781285.jpg [View same] [iqdb] [saucenao] [google]
14142922

>>14142917
But Anon! You are the chosen one!

Chosen to be the Dracolich's husband that is.

>> No.14142923

>>14142918
Of course it is but I could just walk over into their kingdom and have them tell everyone else that I got eaten by wolves or something.

The king wouldn't care if a peasant such as myself went missing.

>> No.14142927

>>14142922
I know there's not a lot of good undead dragon MG art, but I hate when people use this image. Every time I see it, I can only see dat fucked up thigh gap

>> No.14142930
File: 317 KB, 1000x1000, kikimora_final.png [View same] [iqdb] [saucenao] [google]
14142930

here's the real final version.

>> No.14142933
File: 492 KB, 1224x552, 1349917114021.jpg [View same] [iqdb] [saucenao] [google]
14142933

>>14142927
You just had to go and say that. Now I'll never be able to not notice it.

>> No.14142934

>>14142922
W-well, I guess if they need someone to fulfill the roll then I can come along peacefully.

No need for war and all that.

>> No.14142939

>>14142869
>>14142930
I like 'em.

>> No.14142940

>>14142933
Welcome to the club.

>> No.14142941
File: 15 KB, 192x171, 1431991974603.jpg [View same] [iqdb] [saucenao] [google]
14142941

>>14142930

>> No.14142943

>>14142902
Do you think the Wocks care whether or not you "want" them?

>> No.14142948

>>14142927
The skeleton calves are a bit off-putting too, personally.

>> No.14142950

>>14142804
>You come to, fully rested, eyes opening upon your bedroom yet again
>The lich is straddling you, still naked, watching you like a statue
>She doesn't move when you lean up to look at her, instead asking, "SLe ep well?"
>You nod, noting not a single shred of grogginess present in your body.
>Something like the beginning of a smile touches the edge of her lips, and she leans down to lay upon your chest, propping herself up on her small, delicate hands
>"Is it morning?" you ask, not entirely sure how much time has passed since your little session
>The lich nods, still gazing attentively into your eyes
>"Last night was amazing."
>"Mm?" she says, something behind her eyes flickering purple and pink
>"Yeah, you were a natural. I never imagined that sort of stuff was even possible before you tried it."
>At your words, she rests her cheek upon your chest, idly listening to your heartbeat. "Truly?"
>"Absoluetely," you reply without hesitation.
>"I see."
>Then, without warning, she climbs back up, looming over you with her typical poker face, before planting a sudden but loving kiss on your lips.
>Even when she eventually breaks the kiss for the sake of your lungs, her expression never changes. Bored, eyes half-lidded.
>"This was a new area of study for me. I'm glad I was able to pleasure you so."
>You open your mouth to speak, but find her finger there, barring your words.
>"But further research is required?"
>She looks at you expectantly. When you remain silent, wondering just what she might mean, she continues
>"Perform Ear Play upon me tonight. Is this acceptable?"
>You grin, grabbing her slender wrists and pulling her down onto the mattress
>She lets out an emotionless "Oh," of surprise, smiling sleepily as you answer her with your body, kissing and nuzzling

Okay, done. I couldn't translate ASMR and ear-play into writing as well as I thought I could. I hope those reading enjoyed it regardless.
I'll add it to the pastebin link.
I should do more lich stuff.

>> No.14142965

>>14142943
Yes?

>> No.14142983

ZENBU

>> No.14142984

>>14141196
Actually this >>14140618 was me. I'm around, but not being very productive. Kind of like a zombie.

>> No.14142993

>>14142984
Nyan, stop. Those are two hordes that should never be combined. Zombies and rats.

>> No.14142996

>>14142993
Zombie Giant Mice!

>> No.14142997

>>14142993
What could possibly go wrong?

>> No.14142999

>>14142719
Depends on the circumstances, honestly. All I know for sure is that I clearly fucked up if he's only wounded and not dead.

>> No.14143001

>>14142996
Hundreds of them! Nibbling you!

>> No.14143011

I need my Victor fix. Next chapter when?

>> No.14143012

>>14143001
Would they moan 'waaaaarm' like normal zombies?

>> No.14143013

>>14143001
All wanting your waaaaarmth!

>> No.14143017

>>14142950
>I couldn't translate ASMR and ear-play into writing as well as I thought I could.
I don't know what you're talking about, I thought it was great.

>> No.14143030

>>14142719
I don't believe in killing. I'd make sure he was no longer a threat and take care of him until he can leave. Maybe I'd look for a loving rape-free MG to take care of him if he seemed like a good guy.

>> No.14143033

Oh no. You just found out your monster daughteru was secretly enriching and selling weapons-grade uranium to sell to third-world despots and rogue states. How do you discipline her, if at all?

>> No.14143034

>Your wife tells you she wants to try something different in the bedroom tonight
>It's just an old porn video of some sort
>Rather amateurish too
>She seats you naked and makes you start watching it
>The pair look familiar but due to the age of the tape you can't tell from where
>She starts by jerking you off, moving onto rather erotic licking
>She's taunting you the whole time, but it's not the oddest thing a monster girl could do
>As it's getting to the climax she pops her mouth off your dick and rises up against your ear to whisper into it
>She can feel you about to blow
>She times it with the final moments
>When it's over she tells you something
>"You just came to my conception~"

>> No.14143037

>>14143030
>rape-free MG
>rape-free
>MG
?

>> No.14143040

>>14143034
That's alright, I can dig it.

>> No.14143041

>>14143033
>Accidentally read Enriching as Eldriching
Maybe I should stop playing BB

>> No.14143043

>>14143034
>Okay but honey you just got dick-breath in my ear, what the hell.

>> No.14143044

>>14143033
Demand to know who's giving her the uranium! Such a lust for nukes! WHOOOOOOOOOOOOOO

>> No.14143045

>>14142187
>>14142169
>>14142158

and I thought /vg/ was full of overly sensitive assholes, you guys might as well be on fucking gaia with how often you get upset about shit like this.

>> No.14143050

>>14143034
>Nice, we'll have to use that one again sometime.

>> No.14143054

>>14143045
>you should like monstergirls with dicks; stop being so intolerant waaaah

>> No.14143055

>>14143037
Not all of us are here for rape, anon.

>> No.14143056
File: 50 KB, 549x436, ss (2015-09-25 at 08.02.52).jpg [View same] [iqdb] [saucenao] [google]
14143056

>>14143045
And why beholdest thou the mote that is in thy brother's eye, but considerest not the beam that is in thine own eye?

Why are you getting your pantsu in a twist over people getting their pantsu in a twist?

>> No.14143057

>>14143045
Are you defending a tumblr /d/ bastard child drawing?

>> No.14143060

>>14143043
Lost it.

>> No.14143063
File: 87 KB, 500x367, oh.png [View same] [iqdb] [saucenao] [google]
14143063

>>14142950

>> No.14143065

>>14142746
>the Paladin close to death and hypothermia setting in, he makes a last stand
>his plan: to crudely write "free hugs" on his armor
>the Paladin opens his arms and hopes for the best
>he hears a low rumbling in the distance reminiscent of an avalanche
>blurry brown figures come rushing in from everywhere, their blue scarves flying backwards in the wind
>the Paladin closes his eyes as he's tackled to the ground and wrapped in a warm, white, fluffy embrace
>muffled Yeti laughter can be heard echoing down the mountain as he is taken away to their cabin for "treatment"

>> No.14143067

>>14143063
She's lookin' pretty kissable.

>> No.14143069

>>14143063
I want to kiss her
I cannot fight the urge

>> No.14143076

I want to put a gun in a monstergirl's hand, make her point it at my head and tell her to pull the trigger.

>> No.14143082

>>14143076
Okay, but why?

>> No.14143084

>>14143057
not that specifc drawing, but people seemed to be more upset that there's a dick there rather than how godawfully ugly that picture is to begin with.
>>14143054
reading comprehension isn't your forte I see.

>> No.14143089

>>14143084
When someone really dislikes something they tend to focus on that one thing in particular than the rest of the grand scheme of things
Trust me, plan out something for someone one day. You learn a few things

>> No.14143091

>>14143076
>Mamonomanalamadingdong happens
>The bullet becomes nonfatal

Ya blew it

>> No.14143094

>>14143084

That's what I don't get.

I mean I like futa and that thing is an abomination. No one on any side of the argument likes that picture.

>> No.14143095

>>14143017
Thank you. My goal was to try and induce a few of those ASMR shivers through writing, but obviously because no actual sound is involved, it becomes much harder. I suppose if a reader's immersed enough, and susceptible to those sensations, then it can still be pulled off. I just wasn't confident about my attempt.

But thank you for the kind words anyway.

>>14143063
I love it. Wanna cuddle that lich and produce enough heat to make up for us both.

>> No.14143096

https://www.youtube.com/watch?v=eWf63PIrZaE

>> No.14143097

>>14143076
>give it to a big meaty paw girl
>her fingers can't work the trigger anyway

>> No.14143102

>>14143084
>artist is a bonafide tumblr feminist
>adds masculine features purposefully
I know futa is a bit of a tryhard fetish like NTR, but come on.

>> No.14143106

>>14143084
We've seen him draw monster girls that look like they've had they're face go through a blender before. This is just a new low.

>> No.14143107

>>14143096
?

>> No.14143110 [SPOILER] 
File: 35 KB, 895x513, 1443237475861.png [View same] [iqdb] [saucenao] [google]
14143110

>>14142861
>>14142863
>>14142895
>>14142908
Thanks for the love, guys. It's what keeps me truckin'.

What should I do next? http://strawpoll.me/5582100

>> No.14143119

>>14143110
Look if you're going to strawpoll, at least be clear about it.

>> No.14143120

>>14143106
>he also made an altogether pic of most of the MGE
>your waifu is there
Well, ouch.
I wonder if Kenkou sees it he reposts it with his usual "Eh, thanks for contributing I guess" or just silently closes the tab and goes for a good bottle of sake. Or whatever the fuck he intakes with his recent updates.

>> No.14143125

>>14143110
Where's the Climbing up the Walls one? I want my arachnaphobia femdom healing.

>> No.14143126

>>14143110
>Climbing up the walls isn't in the poll
Figures.

>> No.14143128

>>14143120

Yeah, that image is by far the worst thing I've ever see when it comes to monster girls in all time.

>> No.14143143
File: 164 KB, 650x545, ahumiliatingfate.png [View same] [iqdb] [saucenao] [google]
14143143

>>14142719
>>14142746
>>14142738

>> No.14143145

>>14143143
What if he ended up loving Yetis because of this?

>> No.14143146

>>14143143
This is precious.

>> No.14143148

>>14143143
>All those Yeti's
You are already hugged

>> No.14143149

>>14143143
That poor, poor bastard.

>> No.14143153

>>14143149
Indeed. I can't believe they didn't even take off his helmet
That metal must be freezing against his skin

>> No.14143154

>>14143143
Have I ever told you how great you are? As the Yeti fag, I thank you for the smile.

>> No.14143155

>>14143146
I think you can use that word to describe nearly all of this drawfag's stuff. It's got that nice, gently humorous sort of charm to it.

>> No.14143163

>>14143148
Yetis can't hug you if you're on fire.
unless they start piling snow on you.

Then it's fair game.

>> No.14143169

>>14143163
>Being on fire
>In bumfuck nowhere
>During a winter blizzard

>> No.14143171

>>14143169
>Not knowing the prayer of sudden immolation.

Come on man, do you even paladin?

>> No.14143172

>>14143169
When paladins are angry enough, they spontaneously combust.

>> No.14143176

>>14143154
To add to this, my comment got a drawing. I can now die fulfilled.

>> No.14143184

Lich Earplay is now pastebinned, for those who might care.

http://pastebin.com/Zy4hu8xG

If you see any errors or mistakes, please point them out.
Shilling over.

>> No.14143185
File: 122 KB, 700x396, PallyYetiAdventures-Episode2-LetsHelpWendigo.png [View same] [iqdb] [saucenao] [google]
14143185

>>14143145
you know what this means

>> No.14143188

>>14140055
>>14140233
I'm still collecting this in a pastebin, by the way. I'll post it when you finish.

>> No.14143189

>>14143185
What are they helping wendigo with?
Freeing traveler anon who is stuck under a log?

>> No.14143197

>>14143185
>>14143189
Helping build her confidence so she can warm men in her fluffy coat without getting nervous

>> No.14143200
File: 49 KB, 580x329, cardboardtank.jpg [View same] [iqdb] [saucenao] [google]
14143200

Sniper Wendigos.
Sniper Wendigos sneaking about while their husband is in the camouflaged/battle-dress cloak form.

>> No.14143204

>>14143197
But she's so much more cute when she's nervous. Frankly, there's no way I could resist hugging her when she's starts with the nervous"awawawa."

Assuming hypothermia hasn't robbed me of my motor control first.

>> No.14143213

>>14143204
What started the awawa thing, because I can't seem to bring it to mind.

>> No.14143216

>>14143213
I don't even remember, but I like it.

>> No.14143220

>>14143213
>>14143216
I believe it was during a discussion regarding Fultoning monstergirls.

>> No.14143222

>>14143204
Wendigo would be so much better if you could just play with her safely, and not turn insane/hold your eyes while around.

>> No.14143224
File: 493 KB, 1080x1920, D-dog.jpg [View same] [iqdb] [saucenao] [google]
14143224

>>14138682
Someone asked for D-dog in last thread so, there you go.

>> No.14143227

>>14143224
Bless you, Loen.

>> No.14143229

>>14141607
oh please don't leave me hanging like this
>"Uh...I don't think I can sell-"
>"I'll give you 20 gold."
>"Done."
lel

>> No.14143232

>>14143220
I feel like it was before that even.

>>14143222
Frankly I just ignore most of the Wendigo MGE profile, and go for head/thread canon instead because Wendigo's have been one of my favourite monsters since I was a kid and I don't think KC did a great job on their profile.

>> No.14143236

>>14143224
Her makeshift top gives her a bit of a feral look, I like it.

>> No.14143237

>>14143224
>Hellhound

It's shit.

>> No.14143238

>>14143224
Nice.

>> No.14143241

>>14143224
I love that smile.
>>14143237
Get banned again, faggot.

>> No.14143242

>>14143224
Awesome. I love the little wispy trails around the eyes. I'm glad hellhounds brought along that feature.

>> No.14143247

>>14143237
>This cuck

It's shit.

>> No.14143248

>>14142950
Oh man, loved the story. Really easy to get immersed in it.

>> No.14143251

>All this talk about wendigos and their "awawawawa!"

Now I'm imagining that yetis and wendigos operate some sort of emergency service in snowy areas. The yetis help the travellers with first aid and warm hugs, and the wendigos act as transport, with their "awawawawa" siren.

>> No.14143254

>>14143247
Do you even know what "cuck" means?

>> No.14143255

>>14143224
Good dog.

>> No.14143256

>>14143251
>wendigos act as transport, with their "awawawawa" siren.

God fucking damn, that's too cute.

>> No.14143259

>>14143254
'Course I do. I can accurately pinpoint a cuck by his shit taste to a parsec.

>> No.14143265

>>14143259
Isn't a parsec a unit of measurement for distance?

>> No.14143273

>>14143251
All I know is I'm sort of split on them. On one hand I love 'em because they're adorable and I love the winter, but on the other I don't think I could waifu one.

>> No.14143274

>>14143265
If that's true then how did Han make the kessel run in 12 parsecs?

>> No.14143277

>>14143265
Yeah, but I think it still works in that context.
You normally hear "to a 't'" as the common phrase, but the meaning is still there.

>> No.14143281

>>14143274
German Space Magic.

>> No.14143292

>>14143273
Then why not pop down to Wendigo Island? It's the only island on the planet that acts as a sanctuary for wendigos of every shape and size, cold and snowy the year round.
You could even work as a volunteer and get to play with the wendigos every day.

>> No.14143297

>>14143292
Sounds like paradise

>> No.14143300

>>14143292
Tempting, very tempting indeed.

I also now want to see some art of voluptuous adult Wendigo now.

>> No.14143308

>>14143292
I want to ice skate and build igloos with the lonely Wendigos and give them a friend!

>> No.14143311

Where do Wendigos cloaks come from? Do they grow them out of their body or something?

>> No.14143315

>>14143063
Gorgeous.

>>14142950
Pastebin?

>> No.14143318

>>14143292
You know what? I'd be down. For me at least it'd probably be like combination of being a ski coach/patroller and a camp counsellor.

>> No.14143321

>>14143311
They devour wildlife, digesting their fur out of it's natural dye in the process, then eructate it and cover themselves in the more well-maintained parts.
Average Wendigo cloak may consist of up to 50 animals.

>> No.14143326

>>14143308
>>14143318

I want to sleep under a pile of wendigos!

>> No.14143328

>>14143274

The way they explain it is that the faster your ship is you can take a shorter rout on the run while dodging patrols, while slower ships need to take longer routs.

>> No.14143330

>>14143321
That works.

>> No.14143337

>Hike up a snowy mountain
>Pretend to be hopelessly lost
>Pretend to collapse
>Wait until the footsteps get very close
>Pop up and snatch the Wendigo in a hug
It's the perfect plan.

>> No.14143341
File: 1.15 MB, 500x495, 1442444829979.gif [View same] [iqdb] [saucenao] [google]
14143341

So some people were talking about a herd of holstaurs and their protective minotaur onee-san and that inspired me to write this.

http://pastebin.com/KN5URTUd

Touch the cow. DO IT NOW!

>> No.14143348

>>14143341
Fuck whoever added that Minotaur shit to the discussion, ruined the whole thing.

>> No.14143349

>>14143341
I want to be the angsty weak human boy who was bullied as a kid and thus becomes cold hearted as a young adult and tries to bully a Holstaur only to be beaten up by her Minotaur Onee-san who decides that I need to make it up by being her slave until she decides when, and on the way I warm up to her and realize there's more to life, and that the slow peaceful country life with my big strong protective loyal minotaur onee-san is wonderful, and she warms up to me too, seeing me less like an anti social brat and more like a little brother who just needs love and guidance!

>> No.14143351
File: 8 KB, 251x251, OOOOH SHIT.jpg [View same] [iqdb] [saucenao] [google]
14143351

>>14143341
>Someone actually wrote something from that conversation.
I was part of that conversation, and this is glorious, thank you.

>> No.14143355

>>14143348
The minotaur was in the start of the conversation anon.

>> No.14143365

>>14143341
>more minotaur
Nice. If only someone were to write more forced breastfeeding.

>> No.14143366

>>14143365
>breastfeeding

That will never stop being pathetic.

>> No.14143369

>>14143366
And you will never stop being salty about everything.

>> No.14143373

>>14143365
Well, it does have a nursing handjob.

>> No.14143378

>>14143082
so the girl fucks up the shot and shoots through his cheek instead and they watch some towers explode or something followed by that pixies song

https://www.youtube.com/watch?v=5iC0YXspJRM

>> No.14143382
File: 294 KB, 600x800, 1434832424886.jpg [View same] [iqdb] [saucenao] [google]
14143382

>You encounter a wild Anubis with a (HP+++) modifier!
>Choose your action:

>> No.14143383

>>14143369
At least I'm not some faggot who likes being treated like a toddler.

The only breastfeeding that should be happening with a monster girls is with your daughteru and that's it.

>> No.14143393

>>14143383
disgusting, i bet you'd vote for trump

>> No.14143394

>>14143383
Continue being a salty faggot then.

>> No.14143396

>>14143382
>Give her some Richard Simmons tapes.

>> No.14143398

>>14143382
>Hug

>>14143393
>>14143394
Stop reacting to him.
Let him rot.

>> No.14143399

>>14143393
Not American, but I would if I could.

>> No.14143400

>>14143382
I get one of the slaves to tell her that she needs to refrain from the royal chef's cooking a bit.

If I do it she might kill ME.

>> No.14143402

>>14143382
Give her more sweets.

>> No.14143404

>>14143349
wut

>> No.14143405

>>14143382
I don't think she has a stamina modifier. Fuck her to submission!

>> No.14143407

>>14143382
Steal her scepter. That fattie will never catch me.

>> No.14143408

>>14143393
Who isn't voting for Trump? I mean, who else is there? Jeb? Rand? Sanders? Or God forbid Hillary? Trump is the best, pro-wall, pro second amendment, anti TPP/NAFTA, why wouldn't I want Trump?

>> No.14143410

>>14143341
>dat shortstack Holstaur
>dat energetic Minotaur
>dat breastfeeding scene
That was pretty good.

>> No.14143413

>>14143408
I'm voting for John Cena.

>> No.14143416

>>14143408
>voting

>> No.14143419

>>14143416
>Not voting
Do you want another king nigger?

>> No.14143421
File: 72 KB, 540x688, Sup bro.jpg [View same] [iqdb] [saucenao] [google]
14143421

>"Hey pipsqueak, want to come back to my sorority house for some brewskis and nachos?"

>> No.14143422
File: 789 KB, 1280x1670, 7gz6VjT.png [View same] [iqdb] [saucenao] [google]
14143422

less I know you're here you pinoy

Where's more art of this semen alp demon?

>> No.14143423

>>14143419
I don't really care, it's not like I make the difference.

>> No.14143427

>>14143382
Remind her that "free samples" =! "fat free".

>> No.14143428
File: 488 KB, 923x1516, tumblr_nth0ztPRp91r8ououo1_1280.jpg [View same] [iqdb] [saucenao] [google]
14143428

>>14143421
>tfw barely any other artists draw big ]-tittied musclegirls with wide hips and thick thighs

>> No.14143430

>>14143422
Still wating for that smut where both of them taste the dick.

>> No.14143432

>>14143408
>why wouldn't I want Trump?
I won't even grace this with a proper answer.

>> No.14143433

>>14143421
>"You look like my penis would disintegrate the moment I touched your vagina with it."

>> No.14143435

>>14143428
big-tittied*
No idea what happened there.

>> No.14143436

>There are people who would't drink their waifu's milk
What kind of salty ass cretin doesn't like milk? Much less their own waifu's milk. This is incomprehensible to me.

>> No.14143438

>>14143422
I'd fuck that.

>> No.14143440

>>14143423
You say that, and so do tens of millions of other people. If even a quarter of you voted, it'd make an enormous difference.

>> No.14143443

>>14143436
There's a lot of things wrong with me, but a mothering/breast feeding fetish isn't one of them.

>> No.14143448
File: 154 KB, 1024x1304, 1431326922161.jpg [View same] [iqdb] [saucenao] [google]
14143448

>>14143421
"I-I can't... I have, uh, s-study to do..."
>"No way man! We're gonna get you fucking WASTED bro! Wait til' you meet the others in Omega Mu, they're party animals man!"

And then Anon was dragged off before he could safely make it back to the human boy dorm.

>> No.14143453

>>14143448
I would honestly try to kill myself so I didn't have to go.

>> No.14143455

>>14143432
anon when you say stuff like that it tells everyone that you're unable to make an answer, but you still want to win the argument, please refrain

>>14143448
would she let me take shots off her abs?

>> No.14143456

>>14143440
Yeah, but we won't vote anyway. It's just the way things are.

>> No.14143458

>>14143443
>but a breast feeding fetish isn't one of them.
>Implying that's not what's wrong with you
She doesn't have to cradle you in her lap and burp you, man, just grab a tit and suckle.

Okay, so, your waifu is a harpy who can instinctively tell you with 100% accuracy if the egg she lays is fertalized. Do you eat the unfertilized ones?

>> No.14143462

>>14143448
>"Wait, please no! I'm really bad with crowds!"

>> No.14143464

>>14143458
Nope, couldn't do it.

For one thing I hate eggs, another reason would be that it would just feel too weird.

>> No.14143466

>>14143448
Can't we go to beta mu? I hear they're hosting a godzilla movie night.

>> No.14143467

>>14143464
>I hate eggs
>I hate milk

Whatever, Hitler. I bet you hate steak too.

>> No.14143468

>>14143462
Too late Anon, you're going to wake up the next morning with a hangover and your head stuck between gigantic Minotaur breasts, while their owner snores loudly.

>> No.14143471

I want to milk a Minotaur while ignoring her threats for me to stop while she slowly turns into a puddle of pleasure.

I just want to be sexually dominant with a normally dominant monster girl.

>> No.14143476

>>14143466
Maybe if it's a Wurmzilla movie

>> No.14143479

>>14143467
Nothing wrong with them, I just can't stand eggs and milk.

Milk tastes like dirty water and eggs just don't go down right, just like tomatoes and mushrooms.

>> No.14143483

>>14143479
>just like tomatoes and mushrooms.

Okay, this is bait.

>> No.14143486

>>14143436
I'd love to taste preggie sub Dragon's breast milk, then refuse to do it again and say she must think of the baby when she really gets into it.

>> No.14143487

>>14143466
Isn't Beta Mu the Holst dorm that gets tp'd by Omega Mu on a regular basis?

It would be nice to have a quiet night cuddling up with a group of shy Holsts as you watch a movie though.,

>> No.14143488

>>14143458
i would eat my jubjub's unfertilzed ones.

>> No.14143489
File: 664 KB, 678x1200, Anubis.png [View same] [iqdb] [saucenao] [google]
14143489

Fellows of pale skin complexion, how do you like your delicious chocolate girls to hit on you?

>"Ooga booga where da white bois at?" at which point she pins you to the bed and cowgirl rides you all night long
or
>"Might you be the ivory to complement my ebony?" Followed by her taking you out on whimsical dates, making you feel special and loved, but never fucks you until you beg for it, at which point she demands you to get on the ground and worship her entire body, like the lowly maggot you are, and after she's satisfied her sadism and ego, pins you to the bed and cowgirl rides you all night long

>> No.14143491

>>14143458
>>14143464
Uh, if you were looking for an answer from the guy you replied to then no. I would not eat the eggs.

>> No.14143493

>>14143468
Is my virginity intact? Because if it's not I'm going to wait until she wakes up and then demand she take responsibility and become my girlfriend.
And maybe treat me to dinner.
It doesn't have to be anything fancy, it could even just be pancakes at her house.

>> No.14143494

>>14143483
I'm serious anon, I just can't eat them. Absolutely nothing wrong with them or people who like them though

>> No.14143499

>>14143489
>like the lowly maggot you are
And onto the street she'd go.

>> No.14143501

>>14143489
>Nigger vs an even more egotistical nigger

Can I have neither?

>> No.14143505

>>14143494
I guess this is just one of those things I was never meant to comprehend.

>> No.14143507

>>14143489
The second one, just without the pretentious pickup line.
I want her to wrap her legs around my head and make me eat her out.

>> No.14143509
File: 243 KB, 450x600, Crispy.png [View same] [iqdb] [saucenao] [google]
14143509

>>14143489
How about cutesy, fashionable pig girl?

>> No.14143511

>>14143489
First option, but before she would have to take me to a fancy restaurant.

>> No.14143512
File: 332 KB, 1024x1300, 1431328251414.jpg [View same] [iqdb] [saucenao] [google]
14143512

>>14143493
As long as you don't mind having a loud, jock girlfriend, don't expect to go to many classy establishments, she'd probably burp the alphabet to try and impress you or something.

>> No.14143513

>>14143509
Yes please. Served extra crispy with egg, orange juice, and a side of get out of here with your shit.

>> No.14143516

>>14143512
I just threw up in my mouth at the thought of having to deal with that shit.

>> No.14143517
File: 671 KB, 750x1061, 49164659_p0.jpg [View same] [iqdb] [saucenao] [google]
14143517

>>14143499
>>14143501
Enjoy your white women who have smaller breasts and can't even pleasure their men. All white boys crave for those delicious brown breasts which are bigger than white breasts.

>> No.14143519

>>14143489

A hole's a hole. I don't really care. I don't get off on femdom/submission but I'll play along with it if it gets my dick wet, I guess.

>> No.14143521

>>14143517
Still better than a nigger monster girl.

Asian monster girl would be better though.

>> No.14143523

>>14143512
I'm totally into Tomboys, so that's A-okay with me.
But she can't go dragging me to any more parties without asking first. The sex probably wouldn't be bad either.
Would she like video games though?

>> No.14143524

>>14143516
Sodium anon, you don't need to reply to everything if you don't like it you know?

>> No.14143525

>>14143517
There's a difference between delicious brown and black.

>> No.14143527

>>14143489
What way will get me into an Oreo sandwich with two brown girls?

>> No.14143529
File: 1.08 MB, 1113x1600, f_079.png [View same] [iqdb] [saucenao] [google]
14143529

>> No.14143531

>>14143524
Would you want to deal with a monster girl like that? Honestly?

>> No.14143533

>>14143525
There's black and then there's ghetto. I don't want my fuzzy Anubis talking to me like the queen of Detroit.

>> No.14143534

>>14143517
Stop it. You're going to trigger all the /pol/locks in this thread into throwing a tantrum.

>> No.14143535

>>14143529
>That fucking guy's face

God damn that looks awful. hell the girl looks just as bad.

>> No.14143536

>>14143523
>Would she like video games though?
She would like dudebro games like Madden and Halo. Other stuff is for nerd birds.

>> No.14143538

>>14143531
You don't care, so shut the fuck up.

>> No.14143543

>>14143529

I want to taste every inch of her with my tongue.

>> No.14143544

>>14143536
She's getting corrupted so she's not as shit.

>> No.14143545

DESIGNATED
RAPE
STREETS

>> No.14143549
File: 147 KB, 1000x1000, 1420775890788.png [View same] [iqdb] [saucenao] [google]
14143549

>>14143489
The second one. She can be as high-pawed and dominant in the bedroom as she wants, but she's going to have some class in public, damn it. Not settling for one of those little nigglets can't talk or behave properly.

>> No.14143552

>>14143545
Hundreds of Monster Girls just loitering and waiting for men to walk down them.

>> No.14143554

>>14143545
How many of us would be total sluts that hang out on designated raping streets?

>> No.14143555
File: 335 KB, 1233x1917, 1428203308472.png [View same] [iqdb] [saucenao] [google]
14143555

>You will never make a group of powerful monster girls your wives using whatever you can at your disposal.

>> No.14143561

>>14143554
I declare myself guilty. But only for a time, I want to be a husbando too.

>> No.14143563

>>14143554
>Being a slut.
>Ever

>> No.14143568
File: 260 KB, 888x714, 1442199178773.png [View same] [iqdb] [saucenao] [google]
14143568

>>14143555
>a group of powerful monstergirls will never make you their husband using whatever they can at their disposal

>> No.14143571

>>14143536
I'm going to acclimate her to my taste with hype as fuck games.
A steady diet of Platinum games, Hotline Miami, and Payday 2. Among others of course.

>> No.14143572

>>14143545
Streets, really? Get with the times, daddy-o.

Rape Consent Subway Cars have been the trending theme for years now.

>> No.14143573

>>14143563
All men are sluts.

>> No.14143574

>>14143554
If they're utter shit, like just more horny-aggressive XXI century chicks, I'd probably only meet them there for the sake of quick fucks with variety.

If monsters are fantasy land tier true wuv brides, I'd go find my waifu and never bother to even care (not like such places would exist in that case).

>> No.14143576

>>14143568
Good, that's shit.

>> No.14143577

>>14143572
I have to say, I like the amateur porn that comes from filming random men getting raped in the subway bathroom. It's so real and not scripted.

>> No.14143578

>>14143571
What about Devil May Cry?

>> No.14143581

>>14143573
Pure sluts.

>> No.14143583

>>14143576
Shh, let the salt flow through you.

>> No.14143584

>>14143581
Eeeeeehhhhhhhhh.

>> No.14143585

>>14143563

The only acceptable slut is a cuddleslut.

>> No.14143589

>>14143578
Never played it.
So we can experience it for the first time together.
Not the DmC shit though, Donte can die in a pit.

>> No.14143590

>>14143545
Fucking MG India and their wagon wheel flag and their "homemade cooking" that gives you the trots

>> No.14143599

>>14143590
>Implying you wouldn't enjoy the curry of a Girtablu housewife/ex-assassin, made with exotic spices.

>> No.14143600

>>14142217
Blue.
Idgaf what others think, we're gonna have fun.
Probably pot holes bottle rockets at the schools around town.

>> No.14143608

>>14143382
Help her do some crunches.

And then 69.

>> No.14143609

>>14142217

I pick the blue one and take an echinda.

I will turn this world into KCs.

>> No.14143615

>>14143489
>and after she's satisfied her sadism and ego, pins you to the bed and cowgirl rides you all night long
I am 110% okay with this. I mean really, worshiping her entire body? I'd do that without any kind of prodding, positive or negative.

>> No.14143628

>>14143589
Get DMC4:SE.

Story is meh, nobody cares about Nero, but there're some decent moments, and the real draw is the variety of gameplay.

There's nothing quite like the feeling of utterly destroying a gimmick boss with Vergil, who has next to no real counters for them.

>> No.14143629
File: 194 KB, 600x510, 1433814295831.png [View same] [iqdb] [saucenao] [google]
14143629

>>14143615
Mein nigger. This guy gets it.

>> No.14143644

Quick, which do you prefer? Big meaty claws, or big fluffy paws?

I guess you could pick normal human hands too I guess. If you want to be boring.

>> No.14143646

>>14143382
Grope her and make silly noises while making the tassels move, before spanking her on the thigh and running away

>> No.14143647

>>14143609
A man with a dream.

>> No.14143649

>>14143629
Good lord dem paws.

>> No.14143650

>>14143644
Well, they're kind of the same thing. I'd have to go with paws, just my preference.

>> No.14143654

>>14143644
Claws.

>> No.14143655

>>14143644
Don't make me choose anon, I love 'em both!

>> No.14143656

>>14143644
Human hands.

>> No.14143659
File: 179 KB, 928x674, squishy paws.jpg [View same] [iqdb] [saucenao] [google]
14143659

>>14143644
Is that even a question?
>>14143649
What can I say, I like them big.

>> No.14143661

>>14143644
Small claws or paws, with human proportions but fur or scales.

>> No.14143663 [SPOILER] 
File: 150 KB, 700x700, 1443247706513.jpg [View same] [iqdb] [saucenao] [google]
14143663

>>14143382
Buff my wife for ATK++ to mitigate that huge HP pool.

>> No.14143664

>>14143649
I know, right?

The one thing I like best about .less' art is that he draws his MG paws with feasible proportions; larger than hands, but still small enough to use most human-sized tools, door handles, etc.

Not like KC and his catgirls that have digits the thickness of baseballs. I imagine if you dropped them in a human setting, it'd be like any human trying to do anything with slippery oven mitts on.

>> No.14143669
File: 31 KB, 590x276, Limp.png [View same] [iqdb] [saucenao] [google]
14143669

Does KC have erectile dysfunction?

>> No.14143671

>>14143659
They must be so squishy and soft.

>> No.14143676
File: 81 KB, 850x675, Seras.jpg [View same] [iqdb] [saucenao] [google]
14143676

Would you a vampire?
Would you a vampire and her master's loli form?

>> No.14143681
File: 77 KB, 1191x670, 1346823687432.jpg [View same] [iqdb] [saucenao] [google]
14143681

>>14143676
That vampire is silly though.

>> No.14143689

>>14143669
Oh you, google translate.
Probably just whining of being tired drawing monstrs.

>> No.14143693

>>14143681
I love silly vampires!

>> No.14143694

>>14143676
I would irrumate my dick straight into a vampire's needle-sharp fangs.

>> No.14143696

>>14143669
Probably just getting tired from rapid firing profiles out. Must be taxing for him.

>> No.14143697

>>14143664
I'm cool with either one, but I'll admit that there's a certain appeal to the bigger paws for me. I find it funny imagining an Anubis trying to still be all proud & haughty while doing something, then having to ask for help because her paws aren't dexterous enough.

>> No.14143721

>>14143676
Of course I would, Seras is the cutest vampire ever, and Hellsing Ultimate is one of my favorite shoes ever, so yeah give my cute Seras.

>> No.14143727

>>14143644
Paws. I actually can't think of a claw one off the top of my head that I really like.

>> No.14143728

>>14143676
I don't know, is her master's alp form still speaking with a Crispin Freeman/Jouji Nakata voice?

>> No.14143739
File: 152 KB, 833x475, ntr-mermaid-brides-unknown-body-49.jpg [View same] [iqdb] [saucenao] [google]
14143739

I came here to laugh at you. This, was enough to make anyone mad? What the fuck did he think was going to happen to him becoming half fish? This whole thing can be summarized and resolved with: "JUST GIVE HER THE DICK!" I can't get mad at this, the stupid, naïve and dense should have their women stolen, sweet tap dancing aspara holy shit.

>> No.14143741

>>14143728
>alp
Stop this.
And yes. Reminder it is NOT gay to fuck a woman with Jouji Nakata's voice

>> No.14143746

>>14143224
>I missed Loen posting again
Still, it's amazing.

>> No.14143753

>>14143739
>the stupid, naïve and dense
But these will to inherit the Earth. The Bible told me!
Seriously though
>Ahodummy
>getting anyone mad with his stuff

>> No.14143757
File: 300 KB, 979x1251, 1440474107096.jpg [View same] [iqdb] [saucenao] [google]
14143757

Lewd squishy thighs

>> No.14143759

>>14143753
>getting anyone mad with his stuff

You'd be surprised, I sincerely was.

>> No.14143770
File: 2.13 MB, 1980x2800, 1438897842409.jpg [View same] [iqdb] [saucenao] [google]
14143770

>>14143757
Lewd bulging stomach

>> No.14143771
File: 141 KB, 850x638, sample-c2fb03c276ae330a456795b08453002e.jpg [View same] [iqdb] [saucenao] [google]
14143771

>>14143599
The best kind of curry is one that is mildly sweet-tasting and doesn't have the thickness and consistency of slop.
There is good curry, but it certainly doesn't come in pre-frozen packages, that's for sure.

>> No.14143775
File: 127 KB, 800x1275, elf hips- SFW.jpg [View same] [iqdb] [saucenao] [google]
14143775

>>14143757
Thick thighs are great

>> No.14143778

>>14143775
Thick thighs are made for intercrural.

>> No.14143781

>>14143739
I didn't even read that shit.
I mean, seeing the netorare tag is enough to make me go nope.
The only one I actually gave a chance was the lamia one, and goddamn was it good.

>> No.14143782

>>14143739
Frankly it's easier to just look at it as a merchant with a mermaid wife who doesn't mind letting her have a merman finger her when he can't be with her.

The stupidity of it all hurts my head less when taking this view.

>> No.14143792

so if you eat a cookie baked with humpty egg yolk and Wonderland, do you just become an instant ahegaoing cum pump for the next few hours?

what happens if an MG eats the cookie instead?

>> No.14143794
File: 524 KB, 1000x953, 1438657967236.png [View same] [iqdb] [saucenao] [google]
14143794

>>14143775

Oh yes they are

>> No.14143803
File: 369 KB, 761x1000, Gazer.jpg [View same] [iqdb] [saucenao] [google]
14143803

>>14143775
Especially when they come with a small chest.

>> No.14143811

>>14143759
I was raged at his dragon story, but that was years ago and I'd been lurking exhentai for maybe half a year back then.

I dunno, I don't feel anything with these scenes anymore. They now just scream "hot stuff, jerk off" to me over anything else. You could say I'm somewhat like that guy who said he inserts with rapists, just fapping without investing any rational thinking into it, let alone emotions.

>> No.14143812
File: 534 KB, 800x1177, 1432842214750.jpg [View same] [iqdb] [saucenao] [google]
14143812

>>14143803
Meh, I prefer something up top to balance it out, but if there's some quality hips I won't say no.

>> No.14143816

>>14143792
>you eat a cookie baked with humpty egg yolk and Wonderland
I think of restorative properties and of course aphrodisiac

>MG eats the cookie instead?
Loss of self-control for god knows how long?

>> No.14143818
File: 347 KB, 1028x868, 2.jpg [View same] [iqdb] [saucenao] [google]
14143818

I got my book
I'm going to sleep with this Miia under my pillow, while i hug my Miia dakis

>> No.14143822

>>14143818
>those broken tail bones

>> No.14143823

>>14143792
Yep. The girl would probably be flooding a river down there.

>> No.14143831

>>14143811
Ah yes. I recall getting so mad at that dragon story back in the day. Now it's just so cut-and-dry NTR, it's like, why even bother?

Also if you want "Hot stuff, jerk off", might I recommend the works of Xration?

>> No.14143834

>>14143818
Is that the one KC drew the couple 4komas for, or was that something else?

>> No.14143835

>>14143831
You bet I know of him.

>> No.14143840
File: 2.84 MB, 1024x576, How Darling broke his everything.webm [View same] [iqdb] [saucenao] [google]
14143840

>>14143822
Let's be honest, if half the things that happened to MonMusu characters was serious, we'd have a dead Darling

>> No.14143844
File: 414 KB, 875x1431, 1.jpg [View same] [iqdb] [saucenao] [google]
14143844

>>14143834
no, that was the 4koma collection books

this is just a shitload of good fanart

>> No.14143848

>>14143822
snakes dont have bones
do they?

>> No.14143849

>>14143840
To be fair, it's an explicit plot-point that Darling's fucking invincible.

It's why Lala became attracted to him.

>> No.14143851

>>14143848
you're thinking of sharks


snakes are full of bones

>> No.14143854

>>14143848
I know that you do wurm
There is a skeleton inside of you right now!

>> No.14143863

>>14143224
My dick

>> No.14143864

>>14143844
>Miia doing a Santa suit
Cute, but that girl's going to freeze to death

>> No.14143888
File: 217 KB, 450x600, 874669a12fb18bb25fa901cd89fd23e5.png [View same] [iqdb] [saucenao] [google]
14143888

>>14143864
I want santa to bring me horse pussy for christmas.

>> No.14143894

>>14143818

I have an Alice daki, so I do have a lamia daki.

I still wish that anon would share his anubis daki.

>> No.14143895

>>14143888

So how do her internal organs work? Does she have two sets of everything?

>> No.14143896

>>14143894
Anons have managed to upscale the low-res version pretty well.

You can admire the art if nothing else.

>> No.14143897

>>14143864
It's not like clothes are very useful for keeping cold blooded animals warm. Or blankets for that matter.

>> No.14143902

>>14143897
>Implying
Traps body heat, brah. Go nakid, soap up some sun, put some clothes on, trap as much heat as you can.

>> No.14143903

>>14143897
This is true. It's not like clothing or coverings like that create heat themselves. They're made to insulate the body-heat of whatever they're covering. So for a cold-blooded creature like Miia who gives off very little...yeah, not all that helpful.

I wonder if she owns heated blankets or some such.

>> No.14143904

>>14143897
Well, it might keep them from cooling off as fast.

>> No.14143905
File: 545 KB, 1000x1011, 1440469503999.png [View same] [iqdb] [saucenao] [google]
14143905

>>14143888
Will you settle for horse breastpussy?

>> No.14143908

>>14143905
God that kinda posture is my fetish.

Only thing better that boob-pussy like that, is if the girl's in a sweater and you come up through exposed underboob.

>> No.14143909

>>14143905
Only always!

>> No.14143912

>>14143896

I know. I was the anon that upscaled it.

>> No.14143914

>>14143902
>>14143904
That would only be useful in pretty specific circumstances, and for a very limited amount of time.

Any cold-blood that lives in a cold/temperate climate would need heated blankets and a ton of heat packs for their clothes.

>> No.14143915

>>14143863
His dick

>> No.14143916

>>14143905
I don't really get paizuri. I love tits, but paizuri does nothing for me. Is that weird?

>> No.14143917
File: 305 KB, 1200x1120, sweater paizuri_SFW.jpg [View same] [iqdb] [saucenao] [google]
14143917

>>14143908
So this?

>> No.14143920

>>14143914
>That would only be useful in pretty specific circumstances, and for a very limited amount of time.
Nope. Clothes also block the wind. Assuming you're in a warmish environment, you won't lose heat through contact with the wind quite as quickly as not. It's beneficial for cold-bloods to wear clothes, despite how marginal the benefit may be.

>> No.14143921

>>14143916
No, I'm the same.
Massive tits are wonderful, but I don't get the appeal of fucking the gap between them. Perhaps if I ever got to try it I'd change my mind

>> No.14143922

>>14143917
Is there anyone who draws better succubus titties than this artist?

>> No.14143926

>>14143922
He draws the most amazing eyes.
>tfw the sexiest eye colours aren't possible in reality outside of contact lenses.

>> No.14143929
File: 779 KB, 664x909, 1431586978294.png [View same] [iqdb] [saucenao] [google]
14143929

>>14143916
Idon't know about anyone else, but:
>Soft
>Warm
>More control over sensations
>Licking/sucking if she's really good
>Cumming on chest & face
That and just the sight of watching your dick disappear into her cleavage. At least, that what gets me about it.

>> No.14143930

>>14143920
Blocking wind is only useful if your internal temp is higher than the air.

It would only work if you're coming out of a warmer environment into a cooler one,m and only for as long as it takes for your temperature to equalize with the surroundings. Clothes would make that take a bit longer, but that's it.

>> No.14143935

>>14143921
Boobs are soft. Soft things feel nice. Soft things on your dick feel good. Not much to grasp. Plus you get to sit on her chest and watch as she kisses the tip of your dick, and pushes her breasts up and down your shaft.

>>14143930
>lf your internal temp is higher than the air.
Well it would be, assuming you got a little sunbaking happening prior.
>Clothes would make that take a bit longer
Yeah

>> No.14143937

>>14143888
I'd piss her off my repeatedly singing Rudolf the red nose centuar

>> No.14143945

>>14143917
Not quite. It's best to have the tops of the breasts covered, so that when the guy cums, it's all trapped inside, except for a lewd display of it bubbling out the tip of a tent his dickhead makes in the fabric.

>> No.14143948

Were we ever going to get a story of chubby onee-san caterpillar who smokes?

>> No.14143953

>>14143926
>Someone else likes his eyes
They're just so mesmerizing. It's black magic I tells yeah!

>> No.14143960
File: 701 KB, 800x960, 1442758474148.png [View same] [iqdb] [saucenao] [google]
14143960

>>14143945
Had to look around a bit, but here.

>> No.14143961

>>14143960
Oh yes. That's the stuff.

Not quite a sweater, but good enough.

>> No.14143964

>>14143948

>smokes

Absolutely disgusting.

>> No.14143966

>>14143964
Smokes a hookah, not filthy cigarettes.

>> No.14143967

>>14143964
Smoking is cool though! I want a waifu who smokes!

>> No.14143976

>>14143966
>Smokes, a hookah
>Wanting a hooker waifu

>> No.14143979

been thinking alot about bees lately. dont know why.

https://www.youtube.com/watch?v=y1sjruVsUKU

I wonder what the bee girls would say about this

>> No.14143983

>>14143979

Blocked in Canada.

>> No.14143984

>>14143976
Either you're stupid or fucking with me.

I'm going to go with the latter just so I can go to bed and maintain some hope in people.

>> No.14143986

>>14143976
>>14143964
It's a reference to Alice in Wonderland, I think.

>> No.14143993

>Playing Monster Girl Solid
>The Golem, Sahelanthropus-chan, starts moving on her own
>The antagonist of the game, Skullface the Skeleton girl begins shouting before being dragged away by her Zombie guards
>"Wait, who's doing this? Such a lust for a husbando! WHOOOOOOOO?!"

>> No.14143994

>>14143986
I'm surprised, given how prominent Alice in Wonderland is in both MGE and pop culture in general that there are people here who are unfamiliar with it

I mean it's a fucking children's book in the public domain, just google the two books and read them one day.

>> No.14143997

>>14143994

I tried reading it, but I just couldn't sit through it. I was bored out of my skull.

I had just finished reading Greystorm at work and had nothing to do, and that book came pre-loaded on my tablet. Honestly counting bricks on the wall started looking entertaining about 5 chapters in.

>> No.14144001

>>14143997
>A book that defined the literary nonsense genre with some of the best poetry of its type in it
>Boring
There's a fucking caterpillar smoking and they use flamingos for sports if that's boring I don't want to know your definition of exciting.

>> No.14144006

>>14144001

Anyone can write about fantastical things, it doesn't make it interesting automatically.

The whole thing was just a disjointed mess. I realize that was the point, but that doesn't make it good.

>> No.14144016

Would it be awkward to read Alice in Wonderland to your Wonderland Daughterus?

What would little Jabbers think if you read them the Jabberwocky? Would they get scared and demand to sleep with you and mama tonight?

>> No.14144018

>>14144006
>The whole thing was just a disjointed mess. I realize that was the point, but that doesn't make it good
Not talking about this book in particular, but man, 'lel so randumb xD' shit that pretends like it's deep and whimsical and fantastic irritates the fuck out of me.

>> No.14144024

>>14144016
Jubjub chicks would probably get distracted because there's no sex. Or they'd get turned on by something weird like growing and shrinking and eating sketchy cakes.

>> No.14144031
File: 299 KB, 1131x1600, Kunoichi.jpg [View same] [iqdb] [saucenao] [google]
14144031

I still what my shy kunoichi

>> No.14144035

>>14144016
>Read Jabberwocky to kids
>They gets scared
>Storm into your room one night while you're having sex
>'Mama said daddy was gonna slay her with his vorpal blade!'

>> No.14144038

There need to be more stories that take place during the transitional period when the new demon lord girlized all of the monsters.

>> No.14144042

>>14144035
>They all latch onto your arms to keep you from hurting mama
>Spend the night with several little Jabberwocks clinging to you, the massive Jabberwock holding you all and slightly jealous she didn't get that delicious "vorpal blade", the family' pet wock laying at your feet, and your Chesire Cat neighbor looking through the window schlicking

>> No.14144045

>>14144042
>your Chesire Cat neighbor looking through the window schlicking
Lewd.

>> No.14144047

>>14144035
>Your twin daughters burst into your bedroom in the middle of the night, deathly afraid that you're about to kill your wife, their mother
>They find her in Asuka plugsuit cosplay
>You're drilling her doggystyle

>> No.14144049

>>14144047
>Asuka plugsuit cosplay

Latex a best

>> No.14144050

>>14144042
Damn Wonderland, you've been so much, why did you have to adopt egg-laying birth-denied slime lolis?

>> No.14144056
File: 41 KB, 495x480, 1368000859957.jpg [View same] [iqdb] [saucenao] [google]
14144056

>>14144047
>Asuka plugsuit cosplay
Now, why did you have to go and ruin the fun with this shit?

>> No.14144057
File: 97 KB, 461x430, knifeears.jpg [View same] [iqdb] [saucenao] [google]
14144057

Is she right?

>> No.14144061
File: 391 KB, 1000x1008, 1430963193616.jpg [View same] [iqdb] [saucenao] [google]
14144061

>>14144057
Cuter? Maybe.

More molestable? Definitely.

>> No.14144065

>>14144061
You know who's ears I wanna molest? That dark elf chick from GATE. That bitch needs some real sexual bullying for the stunt she pulled.

>> No.14144067

>>14144045
The question is do you let her join in for three way fun, or try to hook her up with that bishie across the street?

Also do you tell her to stop getting your daughterus to call her "Auntie Chesire"?

>> No.14144068
File: 368 KB, 800x800, 1432929052597.png [View same] [iqdb] [saucenao] [google]
14144068

>>14144067
Not invite her for a threeway (unless the wife is really into that), but if she's going to watch I'd make sure to put on a show for her.

>> No.14144070

>>14144065
Anon, didn't you know? She loudly and proudly declares herself Itami's slave, both in the traditional and sexual sense.

>> No.14144073

>>14144067
The only ones who even have a chance to join in are the daughterus. They can call her whatever they want too, as long as she stays out of my damn house.

>> No.14144077

>>14144070
>Itami
He'll never do anything.

>> No.14144078

>>14144068
>if she's going to watch I'd make sure to put on a show for her.
Careful, you know Jabberwocks have a thing for exhibitionism though, be careful!

>> No.14144081

>>14144077
He's a regular animal once Lelei tries her hand at mental reprogramming.

>> No.14144086

>>14144081
I'm only up to ch48, and don't know all the spoilers.

>> No.14144089

>>14144086
That's as far as the manga is, there's a novel and a light novel too.
Itami is hailed as the greatest hero to ever walk the earth in the empire.

>> No.14144090

>>14144078
>Jabberwocks have a thing for exhibitionism
I was unaware of this, but it pleases me greatly
>Let Jabberwock know about the spying cheshire next door
>Lewdly smug grin crosses her face
>Now insists on sex nightly
>Angles herself towards the window as much as possible
>Sucks you off as loudly and lewdly as possible
>Rides you facing the window to display your cock thrusting into her
>Dirty talks very loudly
>Insists on getting as many loads on or in her as possible
Lavishes in every cumshot as suggestively as possible
>Cheshire is trembling at the window, crotch & paws soaked
>Kids have rushed in scared several times from all of mommy's screaming

>> No.14144091

>>14144089
>there's a novel and a light novel too
Translated?

>> No.14144095

>>14144091
Not that I know of, but the manga is up to volume 5 of the LN I believe, which is volume 3 of the novel. 5 novel volumes and 10 LN volumes out so far last I checked.

>> No.14144103

>>14144090
>>Jabberwocks have a thing for exhibitionism
>I was unaware of this, but it pleases me greatly
They do it because they're haughty dragons who think they and their husbands are the best. Because of this, they want the world to know and see just how perfect of a couple they are.

Think Komodo Onee-chan but less stinky.

But damn straight I'd make that Chesire watch everynight and have the Jabberwock scream with pleasure.

>> No.14144108

>>14144103
>Komodo Onee-chan
That was one of the weirdest, most confusing erections that I've ever gotten from this place. And considering some of the shit that's been written here, that's saying something.

>> No.14144110

>>14144108
It was one of my favorite erections.

>> No.14144111

>>14144103
>exhibitionism
Now here's a fetish I could never understand or get behind. Seems kinda childish to show off just to show off, right? What weight does the opinions of others hold? Isn't it just because you want people other than your waifu to see you naked, masturbate to you? Seems kinda slutty.

>> No.14144113

>>14144103
>Komodo Onee-chan
>less stinky
But anon, that's half of the charm! You might as well make her thin!

>> No.14144116

>>14144111
Some people just get off to the idea that other people get off watching them get off. It's a fantasy of being wanted by hundreds of people. Why do you think pornstars exist?

>> No.14144122

>>14144116
>Why do you think pornstars exist?
3D whores who need money and are naturally loose, so taking tonnes of dick is par the course?

>> No.14144124

>>14144113
I was just referring to the exhibitionist part of Komodo onee-chan for reference, I wasn't saying she needed to be changed. Komodo Onee-chan is perfect the way she is, stinky, chubby, lewd, and sweet and loving.

>> No.14144125

>>14144116
Huh, I always though it was the taboo factor causing the adrenaline rush or something like that. Is there a scientific study on this fetish?

>> No.14144126

>>14144122
>>14144116
Also,
>It's a fantasy of being wanted by hundreds of people.
Not gonna start arguing fetishes here, but it's funny that people in a thread so waifu-centric, aren't happy with just being wanted by their waifu.

>> No.14144131

>>14144125

That's also a part of it.

I have the fetish, though there's also the rush from the risk of being seen.

>> No.14144133

>>14144126
Exhibitionism doesn't mean sharing, it just means showing off.

>> No.14144136

>>14144133
I didn't imply otherwise. It's just interesting that even in a scenario with a waifu, there are people who don't care about her opinion and still seek external validation to get off.

>> No.14144137

>>14144136
I understand what you're saying, but in this scenario it's the Jabberwock that has the fetish, not the Anon.

If my waifu had a fetish I didn't have, if it wasn't shit I'd do it for her. Like exhibitionism, I'm not into it and I'd find it incredibly embarrassing, but if she wanted to do it sure.

>> No.14144141
File: 210 KB, 923x564, 1412727306276.png [View same] [iqdb] [saucenao] [google]
14144141

>>14144126
It's not so much that they want to be wanted by others, but more of just knowing that they're desirable or enviable. If you had something that nobody else could have and you knew that a lot of other people would want to see it or wished they could own it, wouldn't you show it off? That's one of the things that exhibitionists get off on, along with being observed doing something normally considered private or intimate.

>> No.14144143

>>14144136
Well duh, it's nothing like being on the shit end of the stick, hence why only female harems are tolerated.

>> No.14144147

You'll probably experience exhibitionism sooner or later with a monster waifu.

Less out of having the fetish and more because when she wants to fuck you, she'll fuck you no matter where you are.

Like someone with a holstaur wife will probably experience it when his wife sees red in a public place.

>> No.14144150

>>14144147
>red in a public place
>traffic lights
Urban life will be hell.

>> No.14144151

>>14144137
Yeah, I guess. I just don't like sharing. And honestly, though it would make me wonder why she's so fixated on having other men and women see her, I'd probably indulge my waifu's fetishes. Even if it did make me wonder if she isn't satisfied with me alone. Man, fetishes are conflicting. Thanks, mamono mana, for getting rid of the things that I don't want.

>>14144141
>If you had something that nobody else could have and you knew that a lot of other people would want to see it or wished they could own it, wouldn't you show it off?
No. They can go fuck themselves. This is mine and mine alone.
> along with being observed doing something normally considered private or intimate.
I guess I just value privacy and intimacy too highly to devalue it by making it not private, and un-intimate. Probably because I've never had intimacy. I wonder if it's a grass is greener thing.

>> No.14144158
File: 472 KB, 1000x933, 4ecd43181fbdf25b0628496c0ce9fa60.png [View same] [iqdb] [saucenao] [google]
14144158

>exhibitionism, sharing, etc.
I want to be part of a bukkake ring of cumslaves that constantly faps for a Succuslut and only gets to touch her when we're about to cum and get to shoot it in her mouth.

>> No.14144164

>>14144158
There's an Alp on my bed!

>> No.14144165

>>14144158
>Sharing
Where the fuck did you get that in any of this dialogue?
>Bukkake cumslave ring
>>/out/

>> No.14144169

>>14144164
It's even better if she's fully dressed and reading a book, not even acknowledging the fappers around her until it's time to turn her head slightly to wrap her lips around a cock that's about to burst.

>> No.14144173

>>14144169
I'd feel depressed if my Alp barely acknowledge my cock.

>> No.14144177

>>14144158

Sharing is not a part of exhibitionism.

It is "look but don't touch" by definition.

>> No.14144179
File: 539 KB, 750x1000, Orin.png [View same] [iqdb] [saucenao] [google]
14144179

>>14144158
Gomi's art makes me want to lick midriffs.

>> No.14144182

>>14144177
>not letting them all cum in her mouth provided they don't touch her
>not watching her play with all the cum in her mouth as you ream her
>not laughing as she chokes on it as she cums and coughs and hacks it all over the park bench and grass as the audience moans in disappointment that she didn't swallow their cum

>> No.14144183

>>14144173
It's probably some cocky Alp who's fully developed and thinks she's the shit.

>> No.14144184

So, question for all you exhibitionists, right
>You're fucking your waifu in the open
>She's moaning telling every one how good you feel
>People watch
>People are jelly as they watch your waifu squirm in orgasm, naturally, people get turned on
>People start masturbating to the sight of you fucking your waifu
>You're really getting into it
>So is she
>So is the crowd
>You cum
>She cums
>They cum
>All over her
How do you react?

>> No.14144185

>>14144169
The unsuccessful girls would be going awry over this kind of porn.

>> No.14144187

>>14144179
Hey, I know this cat!
She likes living dolls too much.

>> No.14144189

>>14144183
Man, if she's going to be that way she's not getting any cuddles tonight, or sweets

I swear this is why you don't fully evolve your Alp, they never obey you, whining about "muh badges"

>> No.14144190

>>14143315

>>14143184

>> No.14144192

>>14144184

Shock at the range of their dicks.

No way they could get that close, on account of a wurms tail flailing about. Anyone that gets within that things range other then me is at serious risk of losing life or limb.

>> No.14144193

>>14144189
Wouldn't you rather be dominated by the onahole stuffed in your Alp's vagina?

>> No.14144196

>>14144184
>Not having a class 1 force field to ensure nobody gets grabby, and no fluids get on you from outside

>> No.14144198

>>14144184
Probably feel pretty good as long as they aren't jerking it on us. That's just gross.

>> No.14144201

>>14144184
I mean, to me this seems the natural and logical result of showing yourself and your waifu off. As described earlier, it;s about showing off what you have and others don't. So it's natural that they want it. They want to sample it. And when they do, it's your fault for hanging it under their noses. Like walking through ghetto slums in a suit literally made out of money.

Is it the risk you get off to? How close to the edge you can get before it's all ruined?

>>14144192
If her tail is in range of them, they are in range of cumming on her
>>14144198
They are, that's the point.

>> No.14144202
File: 1.86 MB, 1000x1354, kasha.png [View same] [iqdb] [saucenao] [google]
14144202

>>14144187
And zombies.
...and regular corpses.
Necrophile housecat FTW.

>> No.14144207

>>14144164
Use it like you would any succubutt?

>> No.14144209

>>14144201
Yeah, I misread that. And that probably where I'd be drawing the line. Exhibitionism is one thing, but once another guy's dick or fluids are involved it just gets weird.

>> No.14144211

>>14144201

I don't think you get it, she's lying on the ground on her back with her entire snake body writhing and snapping about. Most that might happen are a couple of stray shots hitting the tip of the tail, which is nothing but muscled and armoured plates anyways.

>> No.14144214

>>14144193
No, I want the Alp herself! I'm supposed to be the dominant one here!

And if I get femdomed by a smug ara ara Alp all my friend are going to laugh at me

>> No.14144216

>>14144211
>No guys it's okay for other guys to cum on my waifu
Give it time.
>No guys it's okay for other guys to cum in my waifu

>> No.14144218

>>14144202
The unspeakable things I want to do to that cat. I was always awful at 2hu and she was like a brick wall, never beat her on normal mode once.

>> No.14144219

>>14144193
That was horrifying.

>> No.14144220

>>14144211
If MGs were real, there would be some guy that is turned on by cumming on shed armored plates.
Sort of like tile guy, but different.

>> No.14144222
File: 173 KB, 1630x1200, Anon in the Middle.jpg [View same] [iqdb] [saucenao] [google]
14144222

>You will never live in a house with a Devil imouto and a Demon onee-san.

>> No.14144223

>>14144211
This is MGE. One man is a bukkake unto himself. They literally cover your waifu from a safe distance. Stop avoiding the question. How does it make you feel having another man's cum on your waifu? Is it not something you consider when you play out your exhibition fetish? What naturally comes as a result?

I mean it just seems like having a fetish for fucking your waifu falling through mid air, where neither of you can fly. I just want to understand it is all.

>> No.14144226

>>14144218
Wait, 2hu? I thought she was the cat from Kokkuri-san. Well, I am dead tired and it's been a few months since I watched that.

>> No.14144231

Let's be honest, in MGE most men wouldn't be out wandering and masturbating to people fucking in the streets, they'd be in houses or, if they're out, by their wife's side. If they're not married, then they're not in a Demon Realm, in which case you wouldn't be having exhibitionist sex there.

So, your audience would be almost entirely lonely Monster Girls. Maybe a few males, but they'd be married and their wives would make sure they got his cum.

>> No.14144233
File: 503 KB, 1248x1522, 1415080580739.jpg [View same] [iqdb] [saucenao] [google]
14144233

>>14144216
I want to go out with my childhood neighbor that I never liked and pretend to waifu her, only to get her into progressively more depraved shit beginning with public sex, then letting them bukkake her, then letting them use her mouth and so on, until finally I'd make her get impregnated in a bareback bangbang that I'm not even taking part in. Then I'd dump her.

>> No.14144234

>>14144223
Not him, but you seem disturbingly obsessed with other people's cum being all over someone's wife.
Is that you sloppyseconds-kun?

>> No.14144237

>>14144226
Yeah, that's the ever-adorable and nonchalantly sinister Kaenbyou Rin of Subterranean Animism.

My desire to give her hellkittens is very high.

>> No.14144240

>>14144237
>Hellcats

I knew we were missing something in MGE.

>> No.14144241

Where is /pol/ in all it's cuck-smashing might when you need it.

>> No.14144242

>>14144220

If they're shed plates they can be free to knock themselves out.

We'd probably sell them for use in military and industrial armoured plating anyways.

>>14144223

I don't like it at all, but I'd prefer a glass wall between us and any onlookers anyways.

Though the waifu on the other hand, getting covered in their cum would probably just make her mad and violent. I don't think anyone would want to have their dick out infront of a pissed off dragon that wants to rip off a limb or two.

>> No.14144243

>>14144237
>Heckittens
How precocious.

>> No.14144246

>>14144223
It's not really the risk you get off to. It's the knowledge of being watched & being the object of someone's desires. Exhibitionists usually draw the line at letting others get involved. They have something special, they know others want it, and they'll dangle it in front of them but never let them have it. That's why there's usually a camera or window involved.

>> No.14144247

>>14144241
Asleep, like you should be.

Wait, the alps are out right now too, stay awake.

>> No.14144250

>>14144226
Yeah she's a 2hu.
>>14144237
>My desire to give her hellkittens is very high.
Makes two of us After all the grief she gave me I want to stick it in her when she's pinned down by a Hellhound and begging for mercy.

Although it's not really her fault I never got good.

>> No.14144254

>>14144242
>We'd probably sell them for use in military and industrial armoured plating anyways.
>Body armor made with wurm scales
>Nobody can kill anybody else because you'd need to lob a rocket at someone
>And the bunkers are made of wurm scales anyways
>It's all too impractical
>War ends
Wurms end wars.

>> No.14144255
File: 2.65 MB, 4167x3333, 1406412086460.png [View same] [iqdb] [saucenao] [google]
14144255

Word is that Cap'n Onahole is coming into port looking for new recruits. Are you brave enough to join her in her lewd pirate adventures?

>> No.14144257

>>14144222
A Pity, the things I'd do to all that delicious cerulean flesh.

>> No.14144259

>>14144254
That'll just start a new arms race. With ballistic weaponry off the table, it'll probably shift to high-energy explosives, lasers, or microwave weaponry; things that don't care about armor because armor can't block them.

>> No.14144262

>>14144255
Brave enough? Sure. Do I want anything to do with a manticore? No. I'll just wait for the Shark girls to come back to port.

>> No.14144265

>>14144234
It's just alien to me. I can't comprehend it, and I have nothing better to do right now so I wanna try. It seems like exhibitionists straight up turn a blind eye to the realistic outcome of their actions. Or deny what simply comes from doing what they do, no pun intended.
>force fields
>whipping long tails
>there are no men in the crowd anyway
>they can't cum that far
>Glass wall

There always seems to be some kind of failsafe. And I mean, I get why it's there. No one wants other men marking his waifu in their cum. But then why is there a fetish about being put precisely in that situation? Why blueball the inevitable result? It's ike having a fetish for stabbing people in the chest with swords, but then going "Oh, but it doesn't hurt. they don't bleed, they aren't cut." That's what I meant with the earlier analogy of the mid-air sex. "Oh, but we can fly. There's a pillow underneath. We won't fall to our death."

Like, what's the thought process behind this kinda half-way 'sort of but not really' fetish. I need some kinda mad-hatter fetish expert to explain this shit.

>> No.14144269

>>14144262
S-Surely you can't mean those unruly Shark thugs? The ones who cause trouble and get into fights in the harbor taverns? The ones who come ashore looking for some poor young man to drag on-board their ship and h-have their way with?

>> No.14144270

>>14144265

It's because, like I said before, sharing is not a function of exhibitionism.

You're basically looking at people who like anal and asking them why they don't like scat. After all if you stick your dick in an ass there's a chance you'll get shit on your dick.

>> No.14144271

>>14144259
Well, fair enough, but it would still make any combat scenario much more expensive and less likely to be mobilized due to risk of losing equipment.
But what do I know? I'm just some guy on the internet at 3am with no real military knowledge.

>> No.14144273

>>14144237
>My desire to give her hellkittens is very high.
Same here, though I mainly blame Sakurai Energy for that.

>> No.14144276

>>14144270
>sharing is not a function of exhibitionism
you're sharing the sight of your naked wife with people, dumbass.

>> No.14144277

>>14144269
I wont hear any of these horrible accusations. They are lovely pirate girls, and I will join them aboard their ship for their entire next voyage. Nothing can dissuade me.

>> No.14144280

>>14144222
>not Demon imouto and Devil onee-san

>> No.14144284

>>14144276

And that's where it's suppose to begin and end.

>> No.14144287

>>14144277
Then hope the Paladin Navy does not catch you.

>> No.14144290

>>14144270
>You're basically looking at people who like anal and asking them why they don't like scat. After all if you stick your dick in an ass there's a chance you'll get shit on your dick.

Well no, because you can clean the ass so there's no shit. You can't clean the men from the audience who masturbates over you fucking your waifu. Well I mean I guess you can but there's that failsafe I mentioned.
>Theres no male competition in the audience anyway.

This and that aren't the same, see? And the other anon is right. You're still sharing your naked waifu to other men. Sharing the sight of your lovemaking.

It can't be as simple as "I want X, but I don't want to have to deal with Y which naturally and invariable comes after X" I mean I get that that's what a fantasy, a hug box is, but if that's the extent of exhibitionism, that's a very boring explanation for the fetish.

>> No.14144293

>>14144265
If you really want to boil it down, it's pretty much about feeding an ego. If people are watching you, it's because they perceive what you're doing as better or more desirable. That idea of being seen as desirable creates a subconscious idea of superiority that becomes linked to pleasure with sex. The more people watch, the more pleasure they find in it. And since they're getting people to look at them with sex, they'll put it on display to try and have even more people watch. They don't want your dick involved they just want the knowledge that you're looking at them and wishing it was you instead.

>> No.14144294

>>14144255
I asked my father and he told me "Son you could grow up to be a doctor, or maybe a financier. But my son why not consider a life of mmmhphhhm!" and then he had a tailpussy on his face and mom told me to go outside and play, so I guess?

>> No.14144295

>>14144293
It strikes me as a very shallow and selfish fetish. I dunno, maybe it's just me.

>> No.14144298

>>14144214
Like that one guy who tries to bully Alpie and then it got turned around now he's the bitch?

>> No.14144303

>>14144290

And just like you clean the ass to keep shit off your dick you set up a barrier to keep the others off your waifu.

>> No.14144308

>>14144303
>you set up a barrier
you're a wizard now?

>> No.14144309

>>14144031
Shy? But nobody ever sees her anyway.

>> No.14144315

>>14144308
Magic is dumb and unscientific. That's why you can use it by just putting on a pointy hat and making it think you're a wizard.
Did I tell you that magic is actually just nano-Wurms?

>> No.14144316

>>14144303
I still very much feel like this and that are not the same. On the one hand it's your waifu's shit in the first place. Now maybe if she had some one else's shit in her, and you cleaned her ass so some one else's shit didn't get on you, sure.

I really think you're just giving me an example that isn't quite right, and trying to mask it in a way to make it seem like it's the same thing, and therefor reasonable.

>> No.14144317

>>14144295
That could be one way to look at it, but there can be plenty of things playing into it. Look at the story with the komodo lizard: a scrawny kid who was picked on and a girl who was deemed ugly, but when they show themselves off having sex, suddenly those people who ostracized them are jealous of them and want them. Their exhibitionism is a power fantasy based on role reversal, people at the bottom of the social hierarchy becoming the center of attention & desire for just a little while.

>> No.14144318

>>14144308
No, you just do it with her in a glass tank, filled with water and suspended above a major city square for several days.

Like a sexual David Blaine stunt.

>> No.14144321 [DELETED] 

>>14144290
>You're still sharing your naked waifu to other men. Sharing the sight of your lovemaking.
>Letting others see something they might like is a direct invitation to join in.

There is are many things wrong with your reasoning.

>> No.14144322

>>14144317
so exhibitionists are attention whores.

>> No.14144332

>>14144321
>invitation
Spoken or unspoken, you wave cooked steak under a starving man's nose, he'll take a bite.

>>14144317
That really only reinforces the hallow and selfish nature of it. They had eachother yet neither mattered to the other beyond being a tool to gain attention and desire. It could have been any one else, they weren't content alone with eachother.

>> No.14144339

Please stop fighting about exhibitonism and poop, it's distracting us all from the important issues, like whether or not MGs would like Bond movies.

>> No.14144340

>>14144322
Some probably are, but just like any fetish it's going to be different depending on who you ask. People can be outgoing and just want to share what they do with the world, no matter what it is they're sharing. Others might see it as a power trip. Still others it's just a simple desire to be the center of attention.

>> No.14144345

>>14144309
It'll be fun trying to prove she exists.
>Guys seriously, Im marred to a demon ninja!
>sure you are. where is she then.
>she's here... shes just really shy!
>friends look at you like your cazy and leave house.
>Kunoichi still wont leave the ceiling corner
>

>> No.14144346

>>14144339
I heard the new one is going for mass appeal and that they wanted the cod audience as well.

>> No.14144351

>>14144345
How'd you marry her anyway?
>>14144346
>cod audience
>in a Bond film
I, err, uhm. I mean, they did whore themselves out to the Star Wars audience when they rushed out Moonraker, so it's not like that's anything new, but come on.

>> No.14144362

>>14144351
Exact words are "targeting the marvel audience". Even Alp's don't stoop to this level of faggotry.

>> No.14144365

>>14144345
>Catch her sleeping
>Try to take a picture for proof
>She's still sleeping right there while you're looking at her through the camera
>Take the picture
>She's still sleeping there after you take the picture
>She's not in the picture, and the bed is perfectly made like no one was ever there
>"I married David god damn Copperfield what the fuck."

>> No.14144366

>>14144362
>targeting the marvel audience
So after the credits Samuel L. Jackson shows up and recruits Bond to the Avengers? I'm not not-okay with that.
>Even Alp's
Alps are heterosexuals, they're girls who like boys!

>> No.14144367

>>14144332
>Spoken or unspoken, you wave cooked steak under a starving man's nose, he'll take a bite.
Nice false equivalence there. Attaining sustenance while starving and getting your rocks off are nowhere near the same magnitude of importance to anyone.

>They had eachother yet neither mattered to the other beyond being a tool to gain attention and desire. It could have been any one else, they weren't content alone with each other.
Holy mother of all assumptions, Batman! By your definition anything done to enhance a couple's sexual experiences suddenly eliminates any involvement and affection, because they are just using each other. Both parties enjoying sex with the other and getting kicks from a fetish is not mutually exclusive.

>> No.14144370

>>14144365
No, seriously, how did he marry her?

>> No.14144377

>>14144370
easy answer: WITH GREAT DIFFICULTY!
herd answer: he probably got stalked and she married him when he noticed her

>> No.14144379

>>14144255
Sure, I grew up on fishing boats and was a fisherman for a few years as was my father before me.

I'll give it a go!

>> No.14144382

>>14144377
>herd answer
Your Freudian slip has revealed you, Ninja Holst!

>> No.14144385

>>14144377
I think what he means is that nobody besides the husband knows she exists.

If that's the case, then how was the wedding carried out? Who was there to witness it? Did they see the kunoichi?

>> No.14144386

>>14144379
Well if you're accustomed to the smell of fish you'll be right at home...

>> No.14144387

>>14144370
>late for work, taking a short cut through the woods
>accidentally stumble into a kunoichi, somehow catching her unawares
>YEAAARRRRT
>anon is ruthlessly stalked, then wakes up with a ring on his finger one day and a blushing bride
>the blush is drawn onto the mask.

>> No.14144388

>>14144377
*hard

>> No.14144391

>>14144386
To tell the truth the smell of rotting fish, sea salt and sweat smells like home to me, make of that what you will.

>> No.14144393

>>14144382
Maybe it's a Ninja Weresheep, all those abrupt spells of drowsiness suddenly make sense.

>> No.14144395

>>14144367
>Nice false equivalence there
>Anal and exhibitionism are the same thing

>Attaining sustenance while starving and getting your rocks off are nowhere near the same magnitude of importance to anyone.
Regardless, they are both base needs any one will indulge in when the source is flaunting itself infront of them, saying 'look at me, look at me'. You won't weasel out of it by nitpicking.

>By your definition anything done to enhance a couple's sexual experiences suddenly eliminates any involvement and affection, because they are just using each other
Sure, if you're going to twist my words and take it out of context. But when you have a couple hooked on the attention they're getting, and nothing else, because lets face it, attention is the only reason for them to be fucking at school outside, or online. If it were just the pleasure of being together they can do that at home, it's clearly something else. And the story really did come across as, for the nee-san at least, less about caring for and protecting her brother, and more about the exhibitionism by itself, taking him along as a tool to fulfill the fetish, rather than just using the fetish to make them feel better. Perhaps in part that's because we didn't get a look into her mindset, and were limited to the MC's.

>> No.14144396

>>14144388
its to late, your mistake has been acknoleged

>> No.14144397

>>14144385
Could live in a country where you can just hand a form in at their local government office with official seal stamps put onto it and have the license sent to you. Like japan, and.... where else can it work like this?

>> No.14144401

>>14144332
So if you had a certain fetish it wouldn't matter who you did it with as long as you got to live it out? Their exhibitionist fetish came after their relationship started. They'd had sex already.That was a unique and intimate bond, their 'something special'. It was specifically them having sex together that other people were watching and becoming jealous of. Others watching them together reinforces their desire to be with each other and become more intimate. Yes, the entire fetish is ultimately narcissistic on some level, but it is based in a link between pleasure and the bond of their relationship with each other specifically. Healthy narcissism will push you to find feelings of superiority within reasonable limits. It's when the narcissism is pathological that you don't care about who it's withas long as it satisfies you.

>> No.14144402

>>14144397
But I'm more concerned about how the guy found her in the first place.

>> No.14144405

>>14144397
Pretty much everywhere I think.

>> No.14144406

>>14144402
or maybe... she found him?
*dramatic noise*

seriously though, maybe he just actually managed to notice her, or maybe he went out of his way to get some shinobi ass

the world may never know

>> No.14144407

>>14144406
>she found him?
What happened to the shyness? The World demands answers. If the World is not provided with answers, time will stand still.

>> No.14144411

>>14144407
The idea machine is lighting up!

A shy kunoichi, stalking a man but to shy to actually go for him. and the only clue to her being there is the smell of cherry

>> No.14144418

>>14144401
>So if you had a certain fetish it wouldn't matter who you did it with as long as you got to live it out?
Not what I said. Stop doing that.
> Others watching them together reinforces their desire to be with each other and become more intimate.
Calling bullshit here. He only got into it because she was pulling him along, using him to fulfill her exhibitionist streak. At no point does he feel closer to her for becoming less intimate and private, in fact, when they force him to fuck her in front of them, he only starts feeling it as they lose interest. She, presumably, was rearing to go from the get-go.

I'd say for her, her brother was just the only man she had/could fuck, and any other individual in that role would have been fine, it's not like she ever identifies anything particular to him that she finds pleasure in. He just attacks her and she gets off on having other people see her get attacked, as some object of desire.

>> No.14144419

>>14144411
>the smell of cherry
And letters. Gotta be letters.

>> No.14144421

>>14144395
>Anal and exhibitionism are the same thing
I didn't make the comparison. Try addressing the guy who did.
There's nothing to weasel out of, you keep claiming that there is any kind of implied consent anywhere yet fail to provide proof.

>both base needs any one will indulge in when the source is flaunting itself infront of them
And another false equivalence. Also the assumption that people are running on base instincts, devoid of the concept of situational awareness and self control.

>if you're going to twist my words and take it out of context.
You are the one creating a narrative the conforms to your argument. You are the one who's incapable of conceptualizing that two people engaging in a fetish does not void any other kind of personal relations they have.

>> No.14144423

>>14144401
>>14144418
Please stop. This is awful.

>> No.14144430

>>14144419
>At home watching TV eating breakfast
>Its a nice day so the windows are open
>Kunai fly's in and and lands in wall
>find letter attached to kunai smells of cherry
>letter reads "Good morning anon, cereal for break fast again?"
>close window and pull curtain out of fear

Its a start, but im sure someone else could make it better

>> No.14144432

>>14144423
I'm just talking. You have a problem with discussion?
>>14144421
>Try addressing the guy who did.
My bad.
>yet fail to provide proof.
The action itself is implied consent. You have sex in the open you are consenting to having other people watch, be aroused by. You are accepting any responsibility for the effects of the audience your actions cause. You don't get to openly and blatantly flaunt something you have, that others want, and not have them try to take or experience it for themselves. That kind of thinking has only come about recently.
>And another false equivalence.
No it isn't. Both are base needs and people will indulge in both, to reasonable extent if they have the chance. A chance which you are giving them, implicitly. In a MG society, stopping mid-street to enjoy a sex show, dick in hand, is perfectly acceptable, and no one would stop themselves unless they either weren't horny (fat chance) or had their waifu with them or near by, and could sate themselves on them instead. This is a reasonable extent, that given the society, if you fuck openly, you accept as par the course.
>devoid of the concept of situational awareness and self control.
See above.

>You are the one creating a narrative the conforms to your argument. You are the one who's incapable of conceptualizing that two people engaging in a fetish does not void any other kind of personal relations they have
It certainly doesn't void it, but I'm giving a very specific example here in that of the komodo story. You seem to think I'm implying that as a whole, if you enjoy exhibitionism at all to any capacity, you are incapable of personal relations. That's not what I'm saying at all. I'm simply saying that any personal relations they held seem to come second to the desire to fulfill the exhibition fetish.

>> No.14144433

>>14144430
This would drive me mad.

Somewhere, somehow a Kunoichi will always be watching you.

>> No.14144439

>>14144421
>>14144432
To expand upon My last point, exhibitionism exhibits. It can exhibit your personal relationship with some one else, like a dragon dragging her husband along and riding her mate before the town saying, "Look at the glory of my hubsand, isn't he great." in that scenario it doesn't void their personal relations, in fact it extols it.

The example given however, is the opposite. It's not "look at our strong relationship," it's "Look at me". Which, to take all of this back, is in line with my simple observation of "That really only reinforces the hallow and selfish nature of it. They had eachother yet neither mattered to the other beyond being a tool to gain attention and desire. It could have been any one else, they weren't content alone with each other." In which the brother plays only an auxiliary role. This is particularly exhibited during the cosplay event. All eyes are on her. He's only there so that all eyes can also be on her whole she's fucking.

>> No.14144448

>>14143143
>wounded
>unable to flee or defend himself
>he can hear the Yetis closing in
The horror.

>>14143185
That's one tiny Wendigo. Adorable, quiet awawawa-s incoming.

>> No.14144457

Remind me again.
When do you Touch the Cow?

>> No.14144462

>>14144457
At any and all possible times.

I want to give a thirsty kobold holst milk.

>> No.14144464

>>14144457
From time to time, as the toucher in his absolute discretion thinks fit, including now.

>> No.14144465
File: 505 KB, 696x826, 1422124652137.png [View same] [iqdb] [saucenao] [google]
14144465

>>14144457
Never, you let the cow touch you.

>> No.14144466

>>14144457
It's not 'when', but 'where'.

>> No.14144467

>>14144462
>Sudden Yelp as you go get her some food to go with the milk
>Come back
>Kobold is off her feet being pushed up by Xbone heug tits

>> No.14144473

>>14144467
My plan is a success then.
time to lay her in my lap and ruffle her hair.

>> No.14144492
File: 668 KB, 1000x620, Yubel.png [View same] [iqdb] [saucenao] [google]
14144492

Would you get your game on with her?

>> No.14144494

>>14144467
Truly holst milk is a magical thing.

>> No.14144495

>>14144492
Sure.
The game is impregnation.
It needs too players and the goal is to get the girl pregnant.

>> No.14144498

>>14144494
That it is.
Makes one want to sneak into a sabbath meeting and spike their punch with it.

Or their sweets.

>> No.14144499

>>14144492
What would we be playing?

>> No.14144521

>>14144499
This really fun game called cowgirl

>> No.14144526

>>14144521
But she's not a cowgirl, that makes no sense.

Oh well, at least it's not the rape game, I don't want to play that one.

>> No.14144565

>>14144385
She also probably has a family of her own who knows.

>> No.14144584
File: 273 KB, 1024x1224, 1401642260646.jpg [View same] [iqdb] [saucenao] [google]
14144584

>>14144234
>Is that you sloppyseconds-kun?
I'm frankly insulted by the way you think I would be satisfied with other people's cum all over someone's wife. It needs to be sloshing around inside her!

>> No.14144587

>>14144584
Dammit man, the only cum that should be anywhere near someone's wife is their own.

>> No.14144593

>>14144430
Shy stalker kunoichi should be a thing

>> No.14144595

>>14144587
>a slender young wife filled to the brim so that cum spurts out with every thrust into her
>a chubby MILF with big tits and ass riding you with her tits covered in so many paizuri cumshot and missed facials that they drip white like stalactites
Do you even live?

>> No.14144600

>>14144595
Hot. And to think that all of that cum is my own, and I am the only person fucking her.

>> No.14144601

>>14144595
Why not have it be your own cum though??

>> No.14144605

>>14144595
Everything you said is hot as fuck, especially the first one, but only under the context that it's all my cum and I'm the only one fucking her.

>> No.14144608

>>14144595
I hope you're not implying that cum is from someone else.

>> No.14144611

>>14144600
>>14144601
>>14144605
>>14144608
>one-man gangbang
I just don't get you guys. Why would you want to stick your dick in your own cum?

>> No.14144617

>>14144611
https://www.youtube.com/watch?v=-rMJ1NKtBis

>> No.14144618

Would your waifu enjoy whatever show(s) you're currently watching?

>> No.14144620

>>14144611
>says the guy who wants to stick his dick in another man's semen

>> No.14144625

>>14144595
I wish I could have a slender young wife that I could make into a chubby MILF with my cock...

>> No.14144634

>>14144618
I think she'd like Three Kingdoms so yeah.

If not I can always show her Gundam or Fist of the North Star.

>> No.14144638 [SPOILER] 
File: 117 KB, 1600x1200, 1443273656728.jpg [View same] [iqdb] [saucenao] [google]
14144638

>>14144618
Probably not. I doubt a Jinko would be into horror.

>> No.14144642

>>14144638
Would you wash that Abomination's black tears away with your white cum?

>> No.14144643

>>14144638
She'd probably be the sort of person who would just want to fight every horror monster with her own two paws.

>> No.14144649

>>14144620
At least with sloppy seconds you enter into a spiritual brotherhood with your hole brothers. Cumming into and onto your own waifu a hundred times is like masturbation. You're only doing it selfishly to feel good yourself.

>> No.14144655

>>14144618
The last thing I watched was Gakkou Gurashi.
An Ushi-Oni would probably love the moments where it got serious but get bored at all the cute stuff complaining that it needed more zombies.

>> No.14144663 [SPOILER] 
File: 395 KB, 1280x720, 1443274227188.png [View same] [iqdb] [saucenao] [google]
14144663

>>14144642
So far the only actual monsters in this season have been a demon possessing some random farm boy, some creepy deformed cannibals out in the woods behind the asylum, and fucking aliens for some reason.
I don't know how nunbomination fits into all of this, but to answer your question, no, I would not.

>> No.14144674

>>14144663
>nunbomination
2perfect4me

>> No.14144687

>>14144649
Anthony Burch pls.

>> No.14144698

>>14144655
She might start secretly liking the cute stuff though.

>> No.14144701

>>14144698
Ushi Sotomura-san when?

>> No.14144732

>>14144618
Overlord
>"W-what? Why did he do that? That's not how you hug! She's ruined! At least play with her a little, where's the molestation? Where's the hugfucking? Come on, she's cute, I would have atleast resurrected her as a fellow Wight or something..."

>> No.14144736

>>14144649
What do you do when your waifu decides she likes the way your hole brother fucks more than you, and decides to only fuck him and a few others, but not you? Is that when your cuck fetish comes full circle?

>> No.14144739

>>14144698
>She finds herself grinning when you're not looking
>The moment you look at her she tries her hardest to look bored
>Eventually she finds herself being honest and really taking a liking to Taromaru
>She's devastated when he gets bitten
>When he dies she can't help bursting into tears and crying into your arm
>You only manage to cheer her up later that day by making her favourite meal

>> No.14144740

>>14144618

I don't really watch TV though I did watch Inside Out a few weeks ago. She might like it.

It made me imagine how that movie would go down in the HQ if a mindflayer attacked someone's brain

>> No.14144753

>>14144618
>showing Kamen Rider Den-O to a Wyvern
I think she'd get a bit too into it and start posing and saying "I have arrived!" at every turn.

>> No.14144761

>>14143143
Sire Rigid Cobra, get down! The enemy Yetis.

Stay low and crawl along the ground, the snow will camouflage your body heat, preventing the Yetis' heatseeking antennae from pinpointing your position.

We're sending dragoon Pequod to pick you up once you've exited the cold zone.

>> No.14144771

>>14138682
I wanna fuck that egg

>> No.14144774

>>14138682
I just made myself a scrambled egg sandwich for breakfast. I'd never be able to have a Humpty Egg waifu. I like eggs too much. Also I don't want to stick my dick in a yolk.

>> No.14144790

>>14144736
It's not a cucking fetish, and if she want to dump me I will rape her. I'll tie her to a rack and let some orcs and goblins ream both her holes.

>> No.14144795

>>14144771
Buzz off pedophile.

>> No.14144796

>>14144790
And when she laughs at your attempts to get her off? What if she ahegaos instantly when the orcs split her wide, and goes back to being bored when you take over?

>> No.14144798
File: 223 KB, 549x832, Tsk Tsk.jpg [View same] [iqdb] [saucenao] [google]
14144798

>>14143964
>he wouldn't trace his dick all over his troll waifu's tattoos
>he wouldn't pull on his devil imouto's tongue stud
>he wouldn't throw cheese-its through his wererabbit waifu's plugs
>he doesn't want his dark elf to playfully grip his balls with her split tongue
>he wouldn't comfort his angel waifu as she heals from her scarifying his name on her belly
>he wouldn't hatefuck his succubuttt as she sits nailed to a cross and whipped by his doppels
>missionary
>lights off
>under the covers
>handholding
>for procreation
>final pink demon realm

Absolutely Humdrum

>> No.14144811

>>14144761
>snow starts moving like Bugs Bunny tunneling through the ground
>Yetis are confused and intrigued, thinking it might be a Sandworm lost in the mountains
>they follow the moving snow until it stops
>Paladin pops out of the snow
>the Yetis cheer and he still gets his hugs

>> No.14144814

>>14144811
>"Hey, quit kiddin' around."
>"...Sire Cobra? COOOOBRAAAAAA!"

>> No.14144839

>>14144492
Isn't she both sexes? Do not want.

>> No.14144845
File: 1.09 MB, 1600x2000, 1442081980863.png [View same] [iqdb] [saucenao] [google]
14144845

The deadest

>> No.14144850
File: 697 KB, 743x628, 1439346290345.png [View same] [iqdb] [saucenao] [google]
14144850

>>14144845

>> No.14144853

>>14138908
The only reason it's so hard to reproduce for them is because their immune system is hyperactive, human diseases cannot fell them, but the sperm also gets targeted due to that immune system. The Tentacle sap from the Treasured Child Tree acts as an immunosuppressant to weaken it enough to make them able to conceive, they can't have males because even in humans, males do have a higher chance of miscarriage because the immune system deigns the Y Chromosome as a possible pathogen.

>> No.14144858

>>14144850
Reminder that pushy dykes only get bad ends.

>> No.14144864

>>14144858
No bad ends in MGE.

>> No.14144866

>>14143533
Stop giving Writefags ideas!

Those that hate Anubii could now make one.

But to be honest, most Egyptians are of Mixed Mediterranean stock. They only mixed with Native Africans in later dynasties.

>> No.14144877

>>14144858
>>14144864
Obviously turning straight is not a bad end

>> No.14144879

>>14144850
Such good art wasted on yuri.

>> No.14144885

>>14144877
It is to me.

>> No.14144890

>>14144885
Just pretend they're bisexual, they fool around when their husband is at work but throw themselves at him the moment he comes through the door.

The best kind of harems are the ones that know how to have fun with each other too.

>> No.14144895

>>14144885
Faggot's opinions don't count.

>> No.14144896

>>14144890
Replied to the wrong post, meant for >>14144879

>> No.14144906

>>14144864
Precisely, which means no yuri.

>> No.14144910

To anyone who has more experience with strawpoll then me: am I right in being suspicious when a selection jumps from 1 vote to 7 in the space of a few minutes when everything has been stagnant for a while?

>> No.14144912

>>14144890
>they fool around when their husband is at work but throw themselves at him the moment he comes through the door
Ain't that double-timing? Also, I'm not into bisexual stuff either. girl's love doesn't interest me.

Sorry, but most people don't like it here either.

>> No.14144914

>>14144910
Yes.

>> No.14144917

>>14144895
>>14144906
I don't want to get into an argument about this.

Nothing matters anyway.

>> No.14144921

>>14144917
>weekend
>posting yuri
>I-I totally don't want to start shit guys!

-0/10

>> No.14144922
File: 365 KB, 627x1122, 1431652766283.jpg [View same] [iqdb] [saucenao] [google]
14144922

How does your waifu like it when you bylly her?

>> No.14144930

>>14144890
>bisexual
>not husbandosexual

You blew it.

>> No.14144933

>>14144912
>Ain't that double-timing?
If they both belong to you what's the harm. Plus if they get each other warmed up before you get home they're already nice and wet.

Not a fan of pure yuri but bisexuality gets me rock hard, like Sayori's catgirl doujins.

>> No.14144934

>>14144921
I didn't post the picture.

Do you want to talk about Holsts? I like Holsts. Or Apsara, they don't get enough love.

>> No.14144935

>>14144922
>bullying a squeeze
Sure
>bullying your waifu
For what purpose? Is she being bad?

>> No.14144937

>>14144914
Just making sure.

>> No.14144944

>>14144934
No.

I'm coming down with the flu, any other time, sure.

>> No.14144955

>>14144944
Fair enough.

>> No.14144964
File: 586 KB, 723x1100, 52725727_p0.jpg [View same] [iqdb] [saucenao] [google]
14144964

I want a cute Jiangshi to hop her way into my life.

>> No.14144971
File: 260 KB, 768x776, waif fu.jpg [View same] [iqdb] [saucenao] [google]
14144971

>>14144922
I'd get my shit wrecked if I bullied my waifu. Such are the dangers of loving muscles.

>> No.14144985

>>14144971
Or she'd just sit there and take it because she knows she'd destroy you if she retaliated.

>> No.14144986
File: 214 KB, 700x694, 1440818262735.png [View same] [iqdb] [saucenao] [google]
14144986

>>14144922
>Bullying a Hellhound
Might be worth spraying her with a water bottle to get some extra aggressive sex I guess.

>> No.14144988

>>14144985
I wouldn't mind too much if she destroyed me in the bedroom.

>> No.14145006
File: 194 KB, 535x724, No love for dykes.png [View same] [iqdb] [saucenao] [google]
14145006

>>14144933
>If they both belong to you what's the harm
What's mine is mine.
>if they get each other warmed up before you get home they're already nice and wet
>arousal and readiness ever being an issue with monstergirls
No excuses.

>> No.14145014

>>14145006
Fair enough, everyone has their own stances on these things.

Glad that at least KC approves of bi content though, judging by how popular Liliraune seems to be in Japan I wouldn't rule out something similar in future.

>> No.14145038

>>14144964
That actually looks decent compared to the guys other stuff.

>> No.14145046 [SPOILER] 
File: 565 KB, 866x1110, 1443283250532.jpg [View same] [iqdb] [saucenao] [google]
14145046

>>14144935
For fun and to tease her, obviously.

>>14144971
Jinko are cool. You could probably bully her in a sense.
See Pic.

>>14144986
Good taste. I bet pulling her tail is an easy way to set her off too.


Me? I'd probably bully my Titania. I can only imagine what a pouty, upset fairy looks like,

>> No.14145050

>>14145046
I'd rather have my Jinko waifu bully me by forcing me to lick her abs after a workout.

>> No.14145051

>>14144971
I think my waifu would give me a stern talking-to if I tried to bully her, followed by a nice, soft rape to show how much she loves me.

>> No.14145055

>>14145050
>forcing me to lick her abs after a workout.
How is that bullying? That would be like a dream come true.

>> No.14145060

>>14145055
She thinks it's bullying. You just have to make sure she doesn't find out you enjoy it.
Or else she might get even rougher.

>> No.14145066
File: 231 KB, 1200x900, 1440394410215.png [View same] [iqdb] [saucenao] [google]
14145066

>"Hey Little Red, where do you think you're going?"

>> No.14145069

Why don't we have any MG horror stories?
Anon gets kidnapped by some psycho human.
Cursed living dolls luring people into an old decrepit mansion and turning them into dolls as well no, I don't mean alping men into living dolls
Horny frat guys summoning succubi and getting drained dry?
Mantis serial killer collects body parts to make her perfact husbando.
Woman turned ushi oni fucking and accidentally killing whoever they find, not being able to get off and continuing until they find the one that won't break.

Or just horror played straight, nightmare invading your dreams with horrifying visions until they go insane or find a way to vanquish her.

Stuff like that.

>> No.14145072

>>14145069
>Horny frat guys summoning succubi and getting drained dry?
MEH did it.

>> No.14145073
File: 729 KB, 1080x1920, This should placate them.jpg [View same] [iqdb] [saucenao] [google]
14145073

Have you accepted horse pussy into your life?

Or perhaps...you're still waiting on Wonderland Centaur to blow you away?

>> No.14145074

>>14145066
>she doesn't know that's D.D. Hood

>> No.14145078

>>14145073
horse pussy is awful, get it outta here.

>> No.14145080

>>14145069
Because I can't find a way to make any of that sexy. Guess I'm not creative enough.

>> No.14145081

>>14145069
Harblador's Living Doll was a straight-up rape-murderer.

>> No.14145082

>>14145069
Horror doesn't have to involved murder 100% of the time, anon.
Anyways, the things you've listed seem lifted out of shitty slasher films.

>> No.14145086

>>14145082
Monster girl cosmic horror stories would be pretty awesome.

>> No.14145088
File: 319 KB, 642x764, shoujo - parasite.jpg [View same] [iqdb] [saucenao] [google]
14145088

>>14145069
Because Abominations are love and we'd rather impregnate them with our scary boners than shy away.

>> No.14145089
File: 244 KB, 854x724, f15.png [View same] [iqdb] [saucenao] [google]
14145089

>>14145073
10/10 would impregnate.
Even in the frontgina.

>> No.14145098

>>14145069
All sounds like cheap shit, sorry.

>> No.14145104
File: 426 KB, 997x781, 1437341742671.png [View same] [iqdb] [saucenao] [google]
14145104

>>14145082
>>14145098
>doesn't have to involve murder
Didn't say it did, mentioned it because it's the most common.
>slasher films are shitty and cheap

>>14145081
>>14145072
Links please?

>> No.14145105

>>14145069
Because people don't want to write things. If you want it then write it.

>> No.14145116

>>14145088
>we
Abominations are for wiping off the face of the earth in kickass action films. Suffer not the freak to live.

>> No.14145117

>>14145104
Living doll
http://pastebin.com/e1RWvF7f
She was a villain in a previous story, too

>> No.14145120

>>14145104
https://www.literotica.com/s/succubus-summoning-101
First one's here. MEH does a lot of one-off stories, but this is his main series. It's currently at 25 parts, contains all kinds of kinks, and isn't limited to just Succubi. It also contains plant girls, arachnes, elementals, and stoner lizard girls.

>> No.14145125

>>14145120
Oh yeah, I read this one, thanks anyway.

>>14145117
Much appreciated.

>> No.14145128

>>14145117
>if it were better to live a normal life, after all, to try living like her façade for once. But this pleasure, this made all the painful years spent alone in the darkness all worth it
>alone in the darkness
I hope she gets her comeuppance in that manner.
An eternity in solitude and darkness.

>> No.14145135

>>14145128
That would be a horrible end. Wouldn't you rather see her repent and become a nun or a nurse?

>> No.14145139

>>14145128
>power drain through sex
Fuck, my usual punishment fetish, stocks gangrape, would just make her more powerful.

>> No.14145140

>>14145117
>10 adjectives in the span of two sentences
Holy FUCK.

>> No.14145150

>>14145135
No, I just love seeing horrible people receiving fates worth than death appealing.
>her repent and become a nun or a nurse?
Then she'd get away with the fact she'd have blood on her hands, kinda like Alma and many other shitty MGQ girls.

>> No.14145152
File: 393 KB, 1000x1000, Accept the love of Horse Pussy Kingdom!.jpg [View same] [iqdb] [saucenao] [google]
14145152

>>14145078
I get it anon. I understand you completely, you want the horse pussy to come to you instead.

No shame in it really, some men just prefer more aggressive women is all.

Though it sounds more like you're jonezing for Amazonian Horse Pussy.

>> No.14145156

>>14145150
she had blood*

>> No.14145162

>>14145152
What is it like in Horse Pussy Kingdom? Is it pastural grassland? Is it a bleak and hilly realm like Scotland? Is it a broad expanse like the steppes of Mongolia?

Play for me the song of your people, horsefucker.

>> No.14145169

>>14145150
I just want to waifu a beautiful Doll with a dark past that makes her cry when she thinks I can't see her.

>> No.14145176

>>14145104

I used to watch slasher films weekly in an /x/ stream, a couple years ago. It was a lot of fun, great for laughs if anything.

>tfw no MG Freddy vs MG Jason in a sex-off.

>> No.14145177
File: 404 KB, 701x992, Nightmare 2.0.jpg [View same] [iqdb] [saucenao] [google]
14145177

>>14145162
Horse Pussy Kingdom is all those and more my friend, enchanted woodlands with Unicorns, grasslands, steppes, anywhere and everywhere a horse has or can be lies within Horse Pussy Kingdom.

Not even the more unique and dangerous territories are out of reach.

Horse Pussy Kingdom can service anyone anywhere.

>> No.14145193

>>14145152
I demand that the horse pussy kingdom send me their bravest, unmarried, envoy!

She shall come and be treated to the greatest of luxuries.

I myself shall grant her the greatest of welcomes with a personal bedding using manticore venom, the whites of a jub jub egg, and a sticky mushroom mixture to ensure she is as 'fulfilled' as could be.

>> No.14145204

>>14145177
Who are its neighbours? Does it trade with the Undead capital of Cliffsreach? Has it opened diplomatic channels with the nation of Zipangu or made contact with the Mist Continent? Does it owe fealty to the Demon Lord, or are they merely allies under the same banner? How have they responded to the recent incursions from Order-held fiefs? Do they approve of the forcible conversion of Lescatie?

Who is ruling them? Such a lust for men! WHOOOOOOOOO

>> No.14145206

>>14145177
Aint that a cute looking Nightmare.

>> No.14145210

>>14145193
I think you're confusing fulfilled and fully filled.

>> No.14145217

>>14145210
>fully filled
I want to fap into a medical syringe and use it to inject my cum into sleeping virgin girls.

>> No.14145219

>>14145210
There's a difference?
Either way, something is going to be filled.

>> No.14145236

>>14145217
Well that's new.

>> No.14145254

>>14145073
i have accepted. Centorea and bicorn the best.

>> No.14145258

>>14145152
>spoiler

Holy shit the only way that could get worse is if they were futa

>> No.14145261
File: 166 KB, 800x1000, 1398532914630.jpg [View same] [iqdb] [saucenao] [google]
14145261

>>14145152
>Amazonian Horse Pussy.
Would accept into my life.

>> No.14145263

I trying to think up a scene with a evil monster
I need some evil music to inspire me.

>> No.14145271

>>14145263
https://www.youtube.com/watch?v=zayC6NiGQ64

>> No.14145272

>>14145263
https://www.youtube.com/watch?v=jd1r3n4HKOo

>> No.14145273
File: 583 KB, 968x1000, 1437178312304.png [View same] [iqdb] [saucenao] [google]
14145273

>>14145073
>>14145152
Shit nigga, I'm in.

Are there Dairy Breed Nightmares I can sire daughterus with?

>> No.14145275

>>14145263
Nothing better than some organ music for classy ancient evil.
https://www.youtube.com/watch?v=2HadSUXXKNk

>> No.14145276

>>14145263
https://www.youtube.com/watch?v=3ZGIMNplzAQ

>> No.14145278

>>14145263
https://www.youtube.com/watch?v=YOk4LDFSmPc

>> No.14145281

>>14145263
https://www.youtube.com/watch?v=Pf0nmho2rxE

>> No.14145282

>>14145261
Enjoy your hernia.

>> No.14145285

>>14145275
Is it even possible to write non-ominous organ music?

>> No.14145286

>>14145263
https://www.youtube.com/watch?v=GSn4LTlPfIk
>these niggas posting Silent Hill tracks
I'm in good company.

>> No.14145287

>>14145285
Yes. Have you ever gone to church?

>> No.14145292

>>14145219
>There's a difference?
Well yes, with that cocktail she'll be fully filled no matter what, but it would probably be more fulfilling for her is she didn't have to waddle home with a bulging, pregnant belly alone at the end of it all.

>> No.14145294

>>14145263
https://www.youtube.com/watch?v=iFgMBA0lwFE

>> No.14145297

>>14145287
>Have you ever gone to church?
Wheredoyouthinkweare.jpg

>> No.14145298

>>14145287
Yes, and it's all ominous as fuck.

>> No.14145299

>>14145285
Of course it is, you can do some pretty good uplifting pieces.

>> No.14145301

>>14145292
Well, she doesn't have to leave.

I'm sure there's a couple other things we can do to make her stay.
Can't just stop at round one now can we?

>> No.14145302

>>14145286
We are the forgotten, dead and damned.

>> No.14145305

>>14145297
>no one in /mgg/ goes to church
>I'm up to my gills in angry fedoras

Now all the bitching makes sense.

>> No.14145307

>>14145302
Now if only I could the track that plays in that morgue room as James descends(falls) into the Labyrinth.

>> No.14145309

>>14145298
Next you'll say circus organ music is all ominous too.

>> No.14145311

>>14145263
http://vocaroo.com/i/s0yAJ1ws2ZyL
The low quality adds to the ominous feel.

>> No.14145312
File: 390 KB, 412x580, Unicron olev.png [View same] [iqdb] [saucenao] [google]
14145312

>>14145204
>Who is ruling them

A man called the Unicorn King, for he has claimed all the lands Unicorns as his own nigh a century ago, now all Unicorns that inhabit Horse Pussy Kingdom are his daughters /grand daughters.

His harem of Unicorns, aided by several Bi-Corns, are said to remain pure Unicorns by unknown means. It's also said he can be especially tough on his Unicorn daughter's suitors if they should turn them into Bi-Corns.

>> No.14145317

>>14145309
>circus organ music
The fuck? All circus music I've heard has been march music.

>> No.14145318

>>14145312
Does he dress up like He-Man?

>> No.14145320

>>14145305

The fact that monster girls don't exist is all the proof that I need that there is no god.

>> No.14145323

>>14145305
>no one in /mgg/ goes to church
No shit. Anyone here who goes to church would probably be going against a few of the things the bible tells them to anyway

No one likes people who are religious just for show and don't follow what they preach about anyway, if you're going to believe in something stick to it.

>> No.14145324

>>14145312
>The Gariest puritiest Gary purity Stu who ever Stu'd.
your king is shit your kingdom is shit and your pussy is shit.

>> No.14145326

>>14145312

He sounds like an enormous hypocrite.

>> No.14145327

>>14145320
Now, now, there's always the possibility of an evil god.

>> No.14145329

>>14145312
That's retarded.

>> No.14145331

>>14145292
>Not wanting to fill a centaur till she has trouble walking.

Come on man, that should be everyone's goal or something.

Don't you want to send an arrogant, muscled diplomat back to her kingdom bloated and starry eyed?

>> No.14145332

>>14145307
Don't know that one.

.

>> No.14145334

>>14145305
>>14145323
Guys, we know for a fact at least one of us goes to church and would still fuck any monster girl, yet still believes he's a good christian.

>> No.14145335
File: 188 KB, 724x584, 1386997767700.jpg [View same] [iqdb] [saucenao] [google]
14145335

>>14145327

If god was evil then the devil would have given us monster girls to fuck with him.

>> No.14145336

>>14145317
You probably didn't even realize it was an organ because of the key.

https://www.youtube.com/watch?v=aYAsVvmU6gk

>A jolly circus dragon will never play a steam calliope for you with nothing but her breath and a jug of water

>> No.14145340

>>14145335
The Devil works for God, though.

>> No.14145342

>>14145263
when I think of evil women,I think of this
https://www.youtube.com/watch?v=bRCly_SN1As

>>14145294
>alpha gaiden sanger/wodan theme
Mah nigger

>> No.14145343

>>14145340

Then there's nothing worth worshiping anyways.

>> No.14145345

>>14145324
>mfw talking to that guy

I wanted to make him eat all his teeth.

>> No.14145346

>>14138682
I want Accelerator to tell me not to be afraid of that egg!

>> No.14145347

>>14145336
Nope, never heard anything remotely like that at a circus. I'll grant you it sounds pretty cute, though.

>> No.14145348

>>14145305
>>14145323
>>14145327
>>14145334
>>14145340
>>14145343
Hey, lets nip this in the bud before it gets to the extent of the exhibition hole bro shit from earlier.

>> No.14145350

>>14145301
Like all envoys, eventually she'll have to return home. Unless you put a ring on her, but some on. Who'd marry proud and brave centaur?

>> No.14145351
File: 24 KB, 640x360, All the horsepussy.jpg [View same] [iqdb] [saucenao] [google]
14145351

>>14145312
Shut the fuck up Haggard. We all know you're not getting any pussy.

>> No.14145352
File: 1.25 MB, 1680x1050, 1439178531340.jpg [View same] [iqdb] [saucenao] [google]
14145352

>>14145329
The alternative is a Bi-Corn corrupted directly by Deruella, who keeps a harem of men for herself, and leads Horse Pussy Kingdom on a crusade so that all horse pussy is loved from Unicorn to Dairy Breed.

>> No.14145353

>>14145342
Words cannot describe the amount of "Oh Shit" I felt when he first popped up and that played.

Was tempted to throw in Shu's theme but I felt this fit better.

>> No.14145354

>>14145336

I'm more partial to the 1940s model myself.

https://www.youtube.com/watch?v=9_uP-AmUEzA

>> No.14145355

>>14145263
https://www.youtube.com/watch?v=7ktKG-w35kk

https://www.youtube.com/watch?v=c5mrlBZOPEc

>> No.14145356

>>14145340
So everything evil is given green light by god? Rape, murder, torture, war, /d/, sjw's

Time to turn to the gray side.

>> No.14145359

>>14145332
Ah, here it is.
https://www.youtube.com/watch?v=FglCEGlom8c

>> No.14145361

>>14145350
I'm sure she can ask for a request of extended duty here but if she must leave then so be it.

I will welcome the next envoy with open arms and an open bed.

I can only hope they have the intelligence not to send a little shetland nightmare, she won't be walking afterwards.

>> No.14145362

>>14145331
Enjoy the massive mounts of centaur immigrants and visitors that follow once she regales how she was fucked until she couldn't see straight, I guess?

>> No.14145363

>>14145271
>>14145272
>>14145275
>>14145276
>>14145278
>>14145281
>>14145286
>>14145294
>>14145311
>>14145342
>>14145355
thank you for your suggestions

>> No.14145365

>>14145347
Wow. You must not be from America then, because that's been a staple since like the 1860's.

>> No.14145366

>>14145362
Extra income my friend.
The tourism alone would be worth it.

>> No.14145368

>>14145363
What kind of scary monster is it? Some type of monstergirl?

>> No.14145370

>>14145352
>mothchan is THAT character
>the one that yelps when hit so scrubs and ryona enthusiasts pick her
>when she lands a combo she apologizes, if it's particularly long she asks if it hurts, with genuine concern in her voice
>skilled players love her because all the constant apologies drive opponents up the wall

I made myself angry.

>> No.14145372

>>14145366
You'd have to deal with the reputation of being mansluts who just pump and dump centaurs though.

>> No.14145376

>>14145370
That's because you have autism.

>> No.14145377

>>14145372
Oh, she can stay if she wants but we would need to negotiate standings and where she's going to live.

Then there's the whole problem involving conflicting interests and whether she'd be loyal to the kingdom.

On the other hand, I could also see what happens when a bit of doppelganger potion and raging mushroom are added to the mixture.

>> No.14145379

>>14145376
Upvoted

>> No.14145384
File: 356 KB, 432x576, 468c0d18855aad70e2e37af5f7295d92.jpg [View same] [iqdb] [saucenao] [google]
14145384

Gentlemen.
I fucking love Paladins.
I want to hug them from behind when they're still in their armor.
I want to caress their scarred, muscular bodies and make them blush as I slowly un-armor them.
I want to fill them to the brim with my cum and make their faces wet with my kisses.
I want to hold them in my arms all through the night.
I even want them to be friends with the monster waifus in the neighborhood and get my sonnu a nice childhood friend.

>> No.14145385

>>14145361
>little shetland nightmare

Seems like a sensible choice to me. They are less brash and threatening than baseline centaurs. Her size would allow her to get around in and use things designed for humans and roughly human sized humanoid monsters more easily. Their envoy constantly needing help would be quite embarrassing. Well, depending on her site top shelves might be a problem.

Besides, a smaller frame would go a long way to emphasize some big fat centaur titties, proudly showing how bountiful even the runtiest of their kind are.

>> No.14145388

>>14145384
>spoiler

And you were doing so well.

>> No.14145389

>>14145388
Jolly coexistence, knigga.

>> No.14145398

>>14145368
I flipping a coin between two ideas, a long and a short one.

short one is a insane gnome that buries people alive.

the long one is a woman who was betrayed by a church or something. then becomes a demon and works with a mind-flayer and a roper to screw the whole town over.

>> No.14145401

>>14145388
>it has to be a dystopia

>> No.14145410

>>14145370
>>14145370
>paladin chan has two modes, Soldier and Zealot
>Soldier is counter based, needing to be familiar with the roster and having good reflexes
>Tell her opponents to stay down, stop fighting and crap about defending the weak
>Zealot mode makes her outfit bloodstained, accompanied by yandere eyes and slasher smile
>embodiment of rushdown, sadistic, telling her opponents to suffer more, to die, how disgusting they are

Found my main.

>> No.14145416

>>14145388
Coexistence is the best existence.

>> No.14145418

>>14145389
Nah.

>>14145401
>wanting a paladin to despise monsters is dystopia

I guess fire and water should mix, cats should mate with mice and snorting cocaine should make you live forever.

Dumbass.

>> No.14145423

>>14145377
If her ability to properly represent her kingdom's interests were called into question I presume she'd either be recalled or additional observers / aides would be dispatched to examine the situation. Even if they suspect their envoy fell victim to a honeypot scheme, no way multiple ones would.

>what happens when a bit of doppelganger potion and raging mushroom are added to the mixture
You'd need to procure a huge tub to get her hair and fur clean afterwards? Any diplomatic proceedings would also most likely need to be halted while the envoy recuperates from fatigue.

>> No.14145427
File: 8 KB, 400x400, comment_7OCDyxz2atfVD7lSaIqYwTt1yDYy6qSW,w400.jpg [View same] [iqdb] [saucenao] [google]
14145427

>>14145418
You're going to have to try a bit harder than that.

>> No.14145428

>>14145418
>paladins can only be mindless religious fundies and smitebots.
sl8 b8

>> No.14145429

>>14145416
I want to elope with my childhood friend Paladin into a desert region and start a coexistence-based dynasty with her.

>> No.14145430
File: 350 KB, 583x920, So.jpg [View same] [iqdb] [saucenao] [google]
14145430

>>14145416

>> No.14145436

>>14145430
I like modest chests but that's just too flat for me.

>> No.14145441

>>14145427
>>14145428
>bait
You see these nuts, get a good grip and swing from them, the thread may moefy and remove any hint of conflict in everything until it looks it looks like the bastard child of Disney world and my little pony, but I don't have to toe that line. Stay sunshine, I'll be over here enjoying balance.

>> No.14145449

>>14145441
Balance is great, but implying that a Paladin won't in any circumstance ever not be a bad guy is dumb. Even the villains need to be more complex than mindless fanatics.

>> No.14145457

>>14145449
>I can't read

I know.

>> No.14145458

>>14145342
how evil is that woman?

>> No.14145464

>>14145441
I'd prefer to make paladins like racist cops rather than genocidal nazis.

>> No.14145465

>>14145441
>balance is turning a group into bland, samey assholes
Alright then.

>> No.14145468

>>14145353
In OG2 that mech was the first mech that made me worry
there is a difference between shit that's evil and shit thats just there to fuck you up

>> No.14145472

>>14145465
>he says this when every monstergirl is loving and moe not mattering that they're described as sadists or cunts

Okay.

>> No.14145475
File: 315 KB, 650x851, 1385864001090.jpg [View same] [iqdb] [saucenao] [google]
14145475

>>14145464

Good.

I prefer monster girl nazis.

>> No.14145477

Which MG would help you set the universe on fire?

>> No.14145482
File: 129 KB, 680x946, xDQZIru.jpg [View same] [iqdb] [saucenao] [google]
14145482

>>14145475
YES

>> No.14145483

>>14145305
I just came back from seeing the Pope, pretty cool guy.

>> No.14145484

>>14145483
He's a COMMUNIST is hwat he is.

>> No.14145489

>>14145477
An Ignis that can't control it or thinks this is too much fun

>> No.14145490

>>14145483
That's cool I guess?

>> No.14145492

>>14145472
>waaah threadcanon is dumb therefore it justifies my equally shitty retard paladins

Whatever helps you feel better.

>> No.14145497

>>14145477
A Tanuki. If the price is right.

>> No.14145499

>>14145492
>muh last word

Have it kid, you don't even know what you're talking about since you assumed you know my tastes and stared sperging, instead of asking me what I meant. Have a nice weekend.

>> No.14145501

what would you do if Monster girls acted like this?

>> No.14145503

FUCK EVERYTHING
JUST GIVE ME A FUCKING WURM

>> No.14145507
File: 1.71 MB, 1169x1700, 452462347.jpg [View same] [iqdb] [saucenao] [google]
14145507

>>14145475
>>14145482
My brothers

>> No.14145508

>>14145436
Give her a break, she's only like 20 when her species can live to be like 2000

>> No.14145510

>>14143143
>I can feel them, closing in all around me
>That jammy bastard made sure to tie my arms together after he got in that honorless shot to my helmet
>My temple still throbs from the dull pain of his bludgeon
>He had the devil's eyes as he held up a sign saying "Free Hugs"
>It's hanging from my neck
>They're getting closer now
>The snow is crunching with their every hop
>It's like they can sense this damnable sign on my neck
>I can't even move my head due to the frost out here, my entire existence is a popsicle
>He told me to "Check my privilege" before he left, sauntering off like the fruity little pre-Alp he is
>I will have my vengeance, I swear this unto you
>You haven't heard the last of me
>But for now
>I could really use a hug to warm me up

>> No.14145517

>>14145503
What if you got a Wurm raised by Yetis? RIP, your ribcage.

>> No.14145519

>>14143143
>>14145510
This is now gold.

>> No.14145528

>>14145501
I forgot the link like damn fool
https://www.youtube.com/watch?v=578E7p-3tMI

>> No.14145533

>>14145517
Doesn't matter, got Wurm

>> No.14145534 [DELETED] 

>tfw no Shoggoth Dragons

>> No.14145535
File: 266 KB, 858x800, Hug_the_Yeti.jpg [View same] [iqdb] [saucenao] [google]
14145535

The funny thing is, anons want a dystopia but god help whoever implies that they or their waifu would senselessly die in the war/famine/disease.

The thread would be on fire with
"Shitty OP humans"
"My waifu would kill them all"
"A lich would resurrect us"
"GTFO"

It doesn't work both ways anons. You either get a hugbox where you live peacefully or the dystopia where you risk getting the bad end.

Regardless, don't shit up the thread when someone says they prefer one over the other.

>> No.14145551

>>14145535
>the fence sitter that blinds everyone with his wisdom after the argument is over, risking starting it up again

We've come full circle.

>> No.14145558

>>14144367
>>14144421
>all the buttmad in these posts
looks like someone hit a nerve.

>> No.14145559

>>14145535
>don't shit up the thread when someone says they prefer one over the other.

But what if one anon wants to be sexually in charge/not sexually in charge with a monster girl that isn't normally like that? Then we'd have to argue for an hour over some stupid bullshit.

>> No.14145561

>>14145535
Or, you know, you get a normal world where there's sorrow and conflict, but things are usually nice enough.

>> No.14145565

>>14145551
>argument is over
A whole 10 minutes and eleven comments, against an argument that occurs almost every day without fail. Get out.

>> No.14145568

>>14145483

Lilims are the equivalent of the pope for their mother. Think about that for a second.

>> No.14145570

>>14145535
>>14145551
>>14145558
>>14145559
Shut the fuck up.

>> No.14145573

>>14144457
Never. Cows are pathetic, lowly creatures undeserving of love or physical contact.

>> No.14145574

>>14145561
Anon, we can only have extremes here. Pick a side of the fence.

>> No.14145577

>>14145568
I like it.

>> No.14145578

>>14145528
we do not need a mg tryrone

>> No.14145582

>>14145561
I prefer the normal world where things are good in some places and terrible shit in others. You know, like the real world.

>Your hellhound wife will never tell your pups to clean their plate and not waste food because young monsters are starving in demonic not-Africa.

>> No.14145583

>>14145570
Make me you chelsea alp.

>> No.14145593
File: 400 KB, 738x1715, 1430224558882.jpg [View same] [iqdb] [saucenao] [google]
14145593

>>14145582
>Endless swarm of brown girl refugees
I know I'd quarter an Anubis.

>> No.14145594

Which things should a guy do in order to be considered a "cuntease"?

>> No.14145599
File: 487 KB, 570x599, Beyond heresy, love.png [View same] [iqdb] [saucenao] [google]
14145599

I like to think that there are other deity level demons out there who only play by Lilith's rules because they don't want to start an inter-dimensional clusterfuck.

I mean, it's not exactly not a secret KC is shit at world building on the whole.

>> No.14145601

>>14145594
>Smile at an MG
>Wear tight jeans
>Eat tacos or clams

>> No.14145605

>>14145599
Is it time for disgusting STD sex again?

>> No.14145608

>>14145578
>what are manticores, ogres, girtablilu, ushi oni and amazons

>> No.14145613

>>14145593
Finally, a migration we can all agree to

>> No.14145618

>>14145613
If it was 80% slutty young women the feminists would be the first line against refugees.

>> No.14145625

You tried confessing to your favourite monster girl only to be rejected. Not just any kind of rejection though, she verbally attacked you hitting all of your sore points and left you sat there in complete despair.

Your second favourite monster girl has had a crush on you for the longest time and makes it her task to cheer you up without taking advantage of the situation, how does she manage to get you out of the mood you're in?

>> No.14145627
File: 1.31 MB, 726x1280, Mono Plaguebearer.png [View same] [iqdb] [saucenao] [google]
14145627

>>14145605

You tell me.

>> No.14145628

>>14145627
>plaguebearer
She looks more like an abominable Dryad or something. Would without even fliching.

>> No.14145630

>>14145625
Get her to break down and take advantage of the situation. Have a marathon of sweaty rebound sex. There's like fifty different monstergirls I'd be perfectly happy with. And they're all pretty much supermodels in the looks department anyway. Personality matters a lot more in that scenario.

>> No.14145632

>>14145605
It's time for any kind of Warhammer girl sex.

Except Slaaneshi demons. Because God only knows what kind of disgusting things they'd show you that your body is capable of enduring and finding pleasure in.

Like snorting plutonium nyborg up your urethra and going on a radioactive cocaine fuck-fest with a Keeper of Secrets as it smashes its hermaphroditic body into yours

>> No.14145633

>>14145599
I always saw it as something like this:
>Demon Lord: Created this world
>Demon Lord's daughters: Alter large areas just by existing
>'Dieties': Able to affect large areas, but only in limited ways (sunlight, rain, crops, etc.)
>High-tier Demons: Affect only a small area, maybe a city
>Low-tier Demons:Only affect their immediate surroundings, and even then it requires conscious effort

And this is only taking into account magic, not any sort of physical or racial power.

>> No.14145634

>>14145625
Probably spend some time sitting together hugging each other until I silently come to accept it. It's what I'd like most anyway, but I'm not in a position to want anything.

Once I get over it, I'll make sure to be there to help her with anything she needs in return, being loyal to someone who's willing to help you not out of personal interests, but of genuine desire to help is invaluable.

>> No.14145637
File: 939 KB, 683x960, 2bcf72a4bc8297c5f9645a5d43ddd773.png [View same] [iqdb] [saucenao] [google]
14145637

>>14145625
Time. I'd be depressed and bitter for a while after that and liable to lash out at anyone. If she were trying to comfort and/or confess to me immediately afterwards, I'd probably think she was just playing a prank on me.

>> No.14145639

>>14145627
Chaos girl x paladin (or SoB) girl strapon rape when?

>> No.14145641

>>14145632
Birdman girl when?

>> No.14145646

>>14145639
Never.

>> No.14145653

>>14145639
>GWshit, pegging and yuri
I think you broke the shit taste meter.

>> No.14145657
File: 469 KB, 1280x1665, 1437193749725-0.jpg [View same] [iqdb] [saucenao] [google]
14145657

>>14145641
When you write it.

>> No.14145659
File: 229 KB, 574x627, 1425216638642.jpg [View same] [iqdb] [saucenao] [google]
14145659

>>14145646
>not wanting to see a pure paladin ravaged by the terrifying STD's
>not wanting to fuck her extra sensitive boil-filled corrupt hole
>not shivering in pleasure as she cums for the first time in her life from your cock bursting her pustules

>> No.14145661

>>14143110
When it comes to tie-breakers, I always go for the MG with the least amount of representation out of the bunch. So, one short tale of unending hedonism and mild suffering is now in the works.

And for the shoggoth-anon who thought he was slick: http://i.4cdn.org/wsg/1443278416879.webm

Is there a better way to poll that doesn't involve money?

>> No.14145662 [SPOILER] 
File: 242 KB, 902x1000, 1443295086523.jpg [View same] [iqdb] [saucenao] [google]
14145662

Let's talk about MG pubes

>> No.14145665

>>14145659
See? This is good because she is getting the dick.

>> No.14145673

>>14145352
>pick Yeti
>her punches and kicks do 1% damage because of the fluff
>her super is she hugs the enemy, healing them
bugged hugging mechanics, I'm pressing buttons and nothing is happening

>> No.14145674

>>14145661
But I like Shoggoths!

>> No.14145678

Is there a single monstergirl who can defeat the dreaded BAGGER 288?

BAGGER BAGGER

>> No.14145680

>>14145665
She won't get those STD's by magic, anon. That other girl needs to yuri her first.

>> No.14145682 [SPOILER] 
File: 236 KB, 450x500, 1443295526908.jpg [View same] [iqdb] [saucenao] [google]
14145682

>>14145662
I'd rather discuss MG pasties

>> No.14145684

I want to feel up a wererabbit's meaty thighs

>> No.14145685
File: 436 KB, 500x235, 1437610431056.gif [View same] [iqdb] [saucenao] [google]
14145685

>>14145659
I think we've crossed the line, here.

>> No.14145687

>>14145678
https://www.youtube.com/watch?v=loWWXq_Bz74

Nope, not even a Wurm

>> No.14145688

>>14145680
At least a guy should be throat fucking her. At least.

>> No.14145689

>>14145659
>>>/d/

>> No.14145690

>>14145687
As expected.

>> No.14145694
File: 123 KB, 632x342, 12341234.jpg [View same] [iqdb] [saucenao] [google]
14145694

Would you deny the pharaoh her bath?
because mge pharaoh does not bathe in milk

>> No.14145698

>>14145688
>letting another guy irrumate your corruptionfu and give her STD's before you get to fuck her
Are you serious? I understand if you don't like yuri but this is bordering on NTR.

>> No.14145701

>>14145685
This nurgle posting is as bad as waaaaagh shit.

>> No.14145704

>>14145698
No, no, this is a misunderstanding, I mean a guy, in this case it should be me apparently, should throat fuck her while she is being corrupted. There.

>> No.14145707

>>14145704
>replying

>> No.14145708

I want Bollocks and his 40kiddies to fuck off.

>> No.14145711

>>14145708
Second.

>> No.14145714

>>14145708
Me too.
>inb4theWFdefenseforce

>> No.14145717

>>14145704
Oh, alright. That's not bad. I don't think a forced blowjob from a virgin Paladin that's being ravaged and overtaken by a horrible disease would feel good, but having her squirm and moan all over your dick as she's getting infected from behind might be pretty hot. Really get you into the mood to violate her.

>> No.14145719

>>14145694
LEWD!

>> No.14145721

>>14145659
I like my corruption with a bit less puss, phlegm, tumors etc.

>> No.14145722 [SPOILER] 
File: 258 KB, 1366x768, 1443296301322.jpg [View same] [iqdb] [saucenao] [google]
14145722

>>14145704
>>14145717
>>14145721
>>14145659
Fuck off right now.

>> No.14145726

>>14145717
Right? I'm glad we can agree on something.

>> No.14145727
File: 61 KB, 237x496, 1430866131689.png [View same] [iqdb] [saucenao] [google]
14145727

>>14145722
Just... What? There are no words for this kind of shit.

>> No.14145729

This is why we need paladins, because man is the real monster.

>> No.14145730

>>14145727
It's literally the only thing I can think of more disturbing than people fetishizing anything involving Nurgle.

>> No.14145731

>>14145717
Throw in a ring gag for safety reasons. Also because the dripping saliva and unarticulated moans are my fetish.

>> No.14145733
File: 404 KB, 723x1000, Kraken_L.jpg [View same] [iqdb] [saucenao] [google]
14145733

>>14145625

Hugs. Lots of them. Reassuring words would be nice too.

>> No.14145734

>>14145729
Exactly, this >>14145717 is what we need paladins for.

>> No.14145737

What kind of flowers would you get for your monstergirl waifu?
http://en.wikipedia.org/wiki/Plant_symbolism

Is your waifu the kind of girl who would buy you flowers as well?

>> No.14145738

>>14145726
How about taking her virginity while she's still human and gently making love to her and kissing her through her corruption while the corruptor reams her ass to infect her? Her tearful eyes would slowly glaze over and her jaws, locked tight against your sinful tongue at first would slowly open and allow you to enter. The disease would have to progress at an amazing rate, but hey, it's magic, isn't it?

>> No.14145740

>>14145729
>yfw you realize Paladins try to prevent monstergirls from coexisting with humanity for their own good
>They don't fight to keep the monstergirls out, they fight to keep them away from the real monsters, us

Getting waifus? You're no husbands, Anons. Your talents lie elsewhere.

https://www.youtube.com/watch?v=inSxDBQsKdM

>> No.14145741
File: 263 KB, 1632x1224, HjeYnU1.jpg [View same] [iqdb] [saucenao] [google]
14145741

>>14145729
>>14145734
>The Demon Lord turned all the monsters into waifus because she realized humanity are the real monsters
>That either they'd face extinction with a giant FUCK YOU or end up somehow Gary Stu'ing out a victory
>So she makes all kinds of exotic pussy for them to enjoy themselves with
>But the most monstrous of humans want to purge her still
>Even after she gives them like 200 different kinds of pussy that can make you ejaculate just by blowing air onto your dick's mushroom head

Where's the Scary Door when you need it

>> No.14145744

>>14145738
>>14145726
Fuck off to /u/ or /d/ already.

>> No.14145745

>>14145661
I think poll-maker used to save a cookie so people couldn't vote twice, give it a try.

>> No.14145747
File: 3.93 MB, 1700x1202, Lewd Diablo- censored.png [View same] [iqdb] [saucenao] [google]
14145747

>>14145730
Right? I mean, the only one that can really be fetishized is Slaanesh by virtue of being based on lust, and even then it can be taken way too far. Maybe Khorn too if you're into the whole 'hellfire, brimstone, and bloodlust' thing. Pic marginally related.

>> No.14145748

>>14145729
>>14145740
Paladins keep monster girls safe and protected
>>14143185

>> No.14145750

>>14145738
Just kill yourself.

>> No.14145751

>>14145741
Tell me that image is some form of twisted irony.

>> No.14145752

>>14145741
>"I have taken the DNA of all the most evil monster girls and combined them into one creature. THE MOST EVIL CREATURE EVER!"
>"It turns out it's man"

>> No.14145755

>>14145738
Sounds good but we should stop already. Still, nice.

>> No.14145756

>>14145747
Or we could just not talk about Warhammer at all. That would be nice.

>> No.14145758

>>14145738
>>14145726
>>14145717
>>14145704
>>14145665
>>14145659
Stale bait.

>> No.14145763

>>14145741
The demon lord is right?

>> No.14145766

>>14145752
>>14145741
The first thing real humanity would try to do is reverse-engineer monstergirls into weapons of war to use in its eternal inner conflict.

>> No.14145768

>>14145285
Does take me out to the ballgame scare you?

>> No.14145769

>>14145734
>squad of Paladins burst into a Succubus den to rescue their POW comrade
>she's been turned into a cumdump for Incubi who pump all her holes full every day, but her sanctity has kept her human
>she has to try to adjust back to life at the convent but gets flashbacks every time she sees a male
>she falls to the ground and becomes a quivering, crying mess on a daily basis and finally isolates herself in the cellar
>she's your beloved childhood friend
Would you try to help her? Or forget about her as used goods?

>> No.14145774

>>14145738
Not bad.

>> No.14145775

>>14145769
Help her because I'm not purity scum.

>> No.14145776

>>14145769
Why do people feel the need to go full retard?

>> No.14145779

>>14145769
Of course, traumas are some serious hateable shit, especially the rape related ones.

>> No.14145781

>>14145737
I would give her a Chrysanthemum, and she doesn't need to give me flowers, I think I would feel pretty embarrased.

>> No.14145782

>>14145745
Thanks for the suggestion. I'll give it a shot next time.

>> No.14145785

>>14145769
Nah, I wouldn't help her.

>> No.14145786
File: 565 KB, 1600x1200, 1336519203555.jpg [View same] [iqdb] [saucenao] [google]
14145786

>>14145747
Slaanesh isn't based on lust, he's the incarnation of excess. As in ANYTHING that can be used for a different tactile sensation, whether it be pain or pleasure or what-have you.

There's already writefaggotry somewhere from /tg/ with Khornettes, either with ELH's Khornette Quest (amusing read; also the source of that Tzeentch girl and Dryad-Playguu) or Grimoire of the Seven Winds.

Tzeentch is up in the air, who the fuck cares.

We don't talk about Nurgle.

>>14145752
>The DNA of all the evil monstergirls
>Man combines the breeding capacity of wererabbits
>The perpetual estrus of the Jub Jub
>The ability to fetishize anything like a Succubus
>The ability to heal from any non-lethal wound barring straight up regeneration like a Troll or Ushi-Oni
>The superiority complex of a Dragon
>The sheer tenacity and unwillingness to give up like a Wurm
>And
>Above all Else
>The black soul of the Wocks

>>14145763
You know what's scarier? It's not even us that makes US scary. It's our vengeful Mother.

>> No.14145791

>>14145786
Slaanesh is male?

>> No.14145792

>>14145786
Fuck off with the 40k shit already.

>> No.14145795

>>14145769
How about trying to help her without trying to put your dick in her afterwards?

>> No.14145798

>>14145791
Slaanesh is omnisexual. But it's easier to call It a "he" given that It's title is the Prince of Pleasure.

>> No.14145800

>>14145786
See >>14145756

>> No.14145803

>>14145769
Cast her out, she's impure.

>> No.14145805

>>14145791
It's whatever it wants to be. Male, female, herm, neither, or eldritch horror that cannot be labelled, sort of like a Kardashian.

>> No.14145807

>>14145786
I WANT TO FUCK MOTHER EARTH! I want to shift from dimension to dimension and impregnate monstergirls with myself, maturing in seconds after birth and fucking all my mothers at once!

>> No.14145809

>>14145747
>glowing demon holes
Unf.

>> No.14145816

I want /tg/ to leave.

>> No.14145817

>>14145792
Cry me a river thar b'hay

>>14145809
They said horsepussy was the almighty all-vagina. They were wrong. Flashlight vagina is love, flashlight vagina is life.

>> No.14145819

What the fuck is going on here?

Why is this place on fire?

>> No.14145825

>>14145819
/tg/ /d/ and /u/ are shitposting.

>> No.14145826
File: 1.99 MB, 448x252, 1442707624257.gif [View same] [iqdb] [saucenao] [google]
14145826

>>14145819
It's Saturday.

>> No.14145827

>>14145819
Fa/tg/guys don't know when to shut up.

>> No.14145829

>>14145625
Pharaoh didn't force Anubis to do that did she?

>> No.14145832

>>14145816
>>14145825
>>14145827

You do know that most of the old /tg/ grogs hate GW right? This is the 40kiddies work.

>> No.14145831
File: 339 KB, 609x728, yuki snow.png [View same] [iqdb] [saucenao] [google]
14145831

>>14145819
I'm just here so I don't get fined

>> No.14145837

>>14145819
The loli dragons are practicing for show and tell on monday.

>> No.14145843

>>14145737
I'd get her a white carnation.

>> No.14145844

>>14145817
And yet no stories involving a demon's hot, churning, incandescent depths.

>> No.14145845

>>14145831
You know I never thought about it before, but this is some rule of cute thing, right? Why would a snow woman need winter gear?

>> No.14145846

>>14145826
Never ever, tire of this gif.

>> No.14145848

>>14145845
Yes. It was some random request for cuteness like a year and a half ago back when this thread was on /a/. Then someone went through a lot of effort to color it for some reason.

>> No.14145856

>>14145845
>naked Yukis wandering snowy mountains too take men to their homes to warm them up
>clothed Yukis disrobing and giving men their clothes, then jumping them in the snow

One is better than the other.

>> No.14145862

>>14145845
So she can look normal playing with other kids, if she went out wearing her normal dress and sandals she'd get funny looks

Yetis put a scarf on and no one questions their fur bikini

>> No.14145871

>>14145844
There's no reason to write it when the thread gets in a tiff over an autist having their weird, possibly Tile Anon level baitfest and I get blamed for it.

>> No.14145872

>>14145862
>so she can look normal
>she's fucking blue
That aside...
>"Girl, why do you not wear any winter clothes, you'll catch your death of cold! Where are your parents?"
>"I have hyperthermia and my parents are right there"
Done.

>> No.14145878

>>14145871
>tile anon

That was a good day, second only to the dude who actually tried to fuck his mother when 4chan told him to.

>> No.14145880

>>14143659
What is this from? Please and thank you.

>> No.14145882

>>14145769
>she's your beloved childhood friend
Ha, jokes on you, I never had any friends!
But if I did, I'd toss out the used goods.

>> No.14145886

>>14145880
Princess Resurrection.

>> No.14145888

>>14145791
It's a hermaphrodite.

>> No.14145889

>>14145871
That's unfortunate. Still, I implore you to reconsider.

>> No.14145893

>>14145889
Ask TFT or /monster/. Then stay there.

>> No.14145900

>>14145878
Tile Anon is out there somewhere, fucking a Golem waifu made of only the biggest and most ornate bathroom tiles

>> No.14145902

>>14145845
does itt matter? its fucking cute as hell

>> No.14145911

>>14145878
>second only to the dude who actually tried to fuck his mother when 4chan told him to
what

>> No.14145912

>>14145893
>Bringing those two up out of nowhere

Hi bait-kun

>> No.14145916
File: 227 KB, 1200x675, 2850025-1429463341-26.jpg [View same] [iqdb] [saucenao] [google]
14145916

>>14145900
Does it look something like this?

>> No.14145919

>>14145916
Knowing him probably.

He probably enjoys rubbing his dick all over the grooves and shit from the bevels in her tiled body, while she just gives him the most kuu of kuudere stares.

Then he breaks out the "big and beefy" tiles and things get weird

>> No.14145920

>>14145912
>don't want him bringing his /d/generate bullshit in here
>tell him where he should go and stay
>I'm the bait

I won't hold it against you anon, it is the weekend and we're a little on edge, but I'm on your side.

>> No.14145924
File: 90 KB, 400x400, Paladin-chan.jpg [View same] [iqdb] [saucenao] [google]
14145924

never forget Paladin-chan loves you and will protect you from all the bad Monster Girl

>> No.14145925

>>14145920
I think he meant glowing vagina on a strictly cosmetic level though. Like the Three Hole from Callie Maggotbone.

God only knows what that fucking orifice really is.

>> No.14145927

>>14145911
Hold on

>> No.14145933

>>14145920
>a glowing pussy is now /d/er than /d/ and the hights of all depravity

Are you alright, Anon?

>> No.14145935
File: 339 KB, 635x903, 992010edc866f76b2414c55d3729fab6.jpeg.jpg [View same] [iqdb] [saucenao] [google]
14145935

>>14145924
Good thing I stay away from bad monsters and hang out with Angel-chan.

>> No.14145941

>>14145924
Too bad she can't win a waifu war.

>> No.14145962

>>14145935
She's got huge... holy power.

>> No.14145964
File: 221 KB, 624x700, paladin-chan for the win.jpg [View same] [iqdb] [saucenao] [google]
14145964

>>14145941
she'll win one of these days anon just you wait and everyone will be in aw of how great she is and make tons of art and stuff about her and her greatness just you wait

>> No.14145970

>>14145924

Teach has more pressing concerns

Like Muskoids

>> No.14145972

>>14145933
>>14145925
He was talking to Mr. STD pustules yuri corruption, mistakes were made.

>>14145911
I have like 2055 pictures and caps to sort right now so I'll just give you the skinny.
Dude is talking about his slutty mom, how she's always walking naked or semi naked around the house and how sexual she is and how she behaves around him. Anons tell him she wants his dick, father is not in the picture so dude buys it, thinks his mom is frustrated. Goes into her room naked and tells her he wants her. Mother is horrified. Anon is made fun of by the whole thread.

Good times.

>> No.14145973

>>14145964
>she'll win one of these days anon just you wait and then a smug alp will look at her and say 'what took you so long'

Fixed

>> No.14145976

>>14145964
I'll always root for Paladin-chan!

>> No.14145977

Reminder that Lamia eat children.

>> No.14145978

>>14145973
>alp not so smug after having its liver ripped out through it's ass and fed to it

>> No.14145979
File: 19 KB, 419x190, Alp Wins!.png [View same] [iqdb] [saucenao] [google]
14145979

>>14145973

>> No.14145980

>>14145962
Stories about oppai loli guardian angel when?

>> No.14145982

>>14145972
Yeah that guy was a complete /d/ faggot to extreme levels.

I only like Nurglette-chan because she's a monoeye version of Komodo Oneesan instead of every unspeakable disease known and unknown.

>> No.14145984
File: 199 KB, 800x1000, 7a15e6875293f156dd993007af2d0cc56.jpg [View same] [iqdb] [saucenao] [google]
14145984

>>14145977
"Eat"

>> No.14145986

>>14145977
Not the lamias we know and love.
They just find their skin really soft and huggable.

>> No.14145988

>>14145979
That dragon was 2noble.

>> No.14145989

>>14145972
the gullibility of people never ceases to amaze.

>> No.14145990

>>14145980
Op-Op-Oppai Guardian Style!

>> No.14145992

>>14145977
Good, they're annoying, loud and we have too many of them already.

The world needs some Lamias.

>> No.14145995

>>14145992
Snakes are bad, we need all kinds of different dog girls!

>> No.14145997

>>14145989
2012 anyone?

>> No.14145998

>>14145979
thats still bull shit I hope when we do waifu wars again they bring back alp and we'll see just how long it last

>> No.14145999

>>14145992
If there are not humans, all the undead monster girls will go extinct since no new ones to populate.

>> No.14146000

>>14145977
Reminder that because succubi eat from sex that too much will make them a fatty.

>> No.14146002

>>14145995
Would you love a pug girl?

>> No.14146005

>>14146002
Yes, I'd love every single type of canine monster girl.

>> No.14146006

>>14146000
Sex isn't a very good food source. They need to fuck many other beings a day or they will starve to death.

>> No.14146007

>>14146000
>able to change her shape to fit her mate's tastes

Nah

>> No.14146008

>>14145998
The only bullshit here is your mastery of the English language

>> No.14146009

>>14146005
Even those spotted african wild dog-girls?

>> No.14146010

>>14146002
Short, dumb but extremely affectionate? Pug girls would be daughteru tier.

>> No.14146011

>>14146005
Genki, chubby corgi girls a best.

>> No.14146016

>>14146000
>Reminder that because succubi eat from sex that too much will make them level up and gain new skills

Fixed

>> No.14146018

>>14146007
Shape, not mass. Enjoy your dense succubus that crushes bedframes when the commit a ride.

>> No.14146020

>>14146009
Of course.

>> No.14146024

>>14146010
Don't forget ugly.

>> No.14146026

>>14145982
>monoeye version of Komodo Oneesan

That sounds quite nice.

>> No.14146028

>>14146011
Loyal Scottie dog girls are unbeatable.

Jack Russells would be the worst dog girls.

>> No.14146030

>>14145982
>>14146026
So in other words she shit?

>> No.14146033

>>14146018
>magic isn't a thing
>not being able to eat like a pig and not get fat
>not being able to negate her weight

Step it up.

>> No.14146034

>>14146028
Would St. Bernards be the kobold equivalent of a Yeti, just with more booze?

>> No.14146043
File: 311 KB, 721x711, 1403144522779.jpg [View same] [iqdb] [saucenao] [google]
14146043

Big fat cat tats swinging in a tree!

>> No.14146048
File: 424 KB, 1600x1200, 1429382331765.jpg [View same] [iqdb] [saucenao] [google]
14146048

>>14146043

>> No.14146052

>>14146043
>>14146048
I fucking love big fat cat tats!

>> No.14146055

>>14146043
>>14146048
Perfect for giving kittens plenty of milk!

>> No.14146054

>>14146048
Glory to the cat kingdom!

>> No.14146056

>>14146043
M I L K I N G

>> No.14146057

>>14146052
I love big tats!

>> No.14146058
File: 901 KB, 2000x2000, -0.121.jpg [View same] [iqdb] [saucenao] [google]
14146058

>>14146043
Big, beautiful kitty titties!

>> No.14146063

>>14146058
>that art

ABORT! ABORT!

>> No.14146065
File: 147 KB, 850x965, 1435438784040.jpg [View same] [iqdb] [saucenao] [google]
14146065

>>14146034
I'd just settle for a Yeti who likes a drink now and again.

Alone with a Yeti in a log cabin with a decent fire going, sharing a few drinks do the point she gets a little giggly and extra affectionate before getting lost in passion on the floor.

>> No.14146066

>>14146057
I love big tats and big a...sts....

>> No.14146071

>>14146058
>Those nails
KITTY IS GOING TO THE VET!

>> No.14146073

What would your waifu's favorite Kaiju be?

>> No.14146074

>>14146058
>human ears
Soiled it.

>> No.14146076

>>14146073
Gamera

>> No.14146081

>>14146074
The answer is simple, grow two extra arms so you can molest all four at once.

>> No.14146085

>>14146074
>Not having the ability to hear on two different frequencies

>> No.14146086

>>14146076
Does your waifu like /ss/?

>> No.14146090

>>14146074
Mothra.

>> No.14146091

>>14146058
oh no, that lecherous Cat Aunt has had too much to drink, now she's going to molest her nephew!

>> No.14146098

>>14146033
Magic behaves under rules, just like anything else. Would need to cast a lot of magic to expend the excess calories.

>> No.14146109

>>14145986

I like that kinda stuff where MGs have a fetish for human things like an elf having a fetish for human ears

>> No.14146118

>>14146109
Don't all the MGs have elf ears? Were they elves before?

>> No.14146119

>>14146118
Think for a moment.

>> No.14146120

>>14146098
Okay nigga, be boring, I'll be over here pigging out with the succubus not getting fat.

>> No.14146123

>>14145982
>monoeye version of Komodo Oneesan
Grats dude, you somehow made her even more low.

>> No.14146125

>>14146098
Not in these threads they don't. Apparently in these threads magic makes you a literal god.

>> No.14146127

>>14146120
Not gaining weight from gluttony is the more boring version. What is the point of predatory behaviors otherwise?

>> No.14146130

>>14146118
In nippon, "Elven ears" aren't specific to Elves themselves, and are even viewed as "demonic" to a degree.

Hence why you see some artists like KC giving Elf ears to his Lamias and Harpies.

>> No.14146133

>>14146120
What if I want a chubby Succubus to cuddle though?

>> No.14146135

>>14146123
As if I give a shit what the vocal minority of the thread thinks about my taste in waifus.

>> No.14146139

>>14146133
I judge for having shit taste.
But >>14146007

>> No.14146142

>>14146135
>vocal minority
>that doesn't like /d/
>there's a silent majority in the thread that wants to fuck girls bursting with pus and disease
>and all other kind of /d/ shit.

Now where have I heard this before?

Careful not to fall for it.jpg

>> No.14146143

>>14146130
Lamias and Harpies shouldn't have their ears visible at all. Just feeling vibrations with their skulls and small opening of the side of the head respectively.

>> No.14146146

>>14146118
Pointy ears are demon ears. All monstergirls are part succubi.

>> No.14146149

>>14146142
I'm not even referring to the shit the /d/ guy was pushing. I'm talking about MY personal vision for the character.

Eat shit.

>> No.14146151

>>14146146
This is why the mechanics of this universe are inherently fucked.

>> No.14146152

>>14146143
They work as erogenous zones.
That, and I like the look of them.

>> No.14146154

>>14146133
>>14146139
>>14146007
I want a story about a lewd popular succubus who has a killer body and is beloved by all, and sets her sights on a seemingly normal guy, but when she changes to be his "ideal form", she ends up blimping up to an obese succubus and made the laughing stock of the whole town

And when she tries to change back she fails, and realizes that his "ideal woman" is apparently shit at magic

>> No.14146156

>>14146149
Don't engage him.

>> No.14146158
File: 771 KB, 1024x1024, 1407179439431.jpg [View same] [iqdb] [saucenao] [google]
14146158

>>14146149
Would you a voluptuous chubby unwashed fujo monoeye?

>> No.14146159

>>14146154
This is why passive shape-shifting is shit.

>> No.14146161

>>14146149
Watch that blood pressure anon, we're going to have cut the salt in your diet.

>> No.14146163

>>14146158
>Asymmetrical face
no

>> No.14146166
File: 310 KB, 850x1111, 1435629774935.png [View same] [iqdb] [saucenao] [google]
14146166

>>14146158
I'd any monoeye.

>>14146161
Yeah sure why not. I'm already at risk for hypertension because of all the sodium and may as well be Lot's Wife

>> No.14146167

>>14146154
Is this a punishment story? Cause that's brutal. Is she a bad person?

>> No.14146172

>>14146158
Until she had a heart pupil and beyond.

>> No.14146173

>>14146167
It is a succubus.

>> No.14146175
File: 3.37 MB, 400x400, 52676725.gif [View same] [iqdb] [saucenao] [google]
14146175

>> No.14146177

>>14146158
>unwashed
I'm not a pig
>fujo
You can whip that out of her tight?

>> No.14146178

>>14146177
No. She would kill you for that.

>> No.14146181

>>14146173
Don't pull that crap.

>> No.14146189

>>14146158
Does she at least shave?

>> No.14146191

>>14146178
She can try.

>> No.14146192

>>14146189
You know she doesn't. If you pull out, you'll paint her black bush white.

>> No.14146194

>>14146181
Her very existence means she preys on the innocent

>> No.14146197

Is fujo Cyclops the next chubby alp sempai? Gettig real tired of that faggot and his covert yaoi advertising.

>> No.14146199

How come only some wear clothes?

>> No.14146200

>>14146175
Too cute.

All of MON was great.

>> No.14146204

>>14146197
yaoi is more interesting than the trend of people here to take the monster out of monstergirls tbh

>> No.14146209

>>14146197
>fujo Cyclops
>yaoi
But isn't the usual fujoclopsfag just an ultra sub? It's always 100% hetero.

>> No.14146210
File: 1.32 MB, 640x360, barf.gif [View same] [iqdb] [saucenao] [google]
14146210

>>14146192
>Doesn't take care of her body
>Doesn't try to maintain her appearance
>Doesn't even bathe

Sorry but I'm at my limit. Even alps have standards.

>> No.14146211

>>14146204
>This is a fishing pole

>> No.14146213

>>14146197
Probably the monster boy fag trying something else now he knows it's impossible to force them here.
>>14146204
>Homosexuals are better than cute girls
>>>/hm/

>> No.14146216

>>14146213
Muscular savage monster guys when?

>> No.14146218

>>14146209
What the crap to you think a fujoshi is?

>> No.14146223

>>14146216
When Franky comes back to rape Cathyl

>> No.14146225

>>14146218
A girl that gets off to porn of dudes.
Like how guys like lesbians.

>> No.14146228

Sub

Hellhounds.

>> No.14146229
File: 883 KB, 1920x1080, The-Joker-Fire-Artwork-Poster-Wallpaper.jpg [View same] [iqdb] [saucenao] [google]
14146229

>This thread
Someone post cure Yeti stuff, asap.

>> No.14146232

>>14146225
Not just porn, homosexual relationships. Does that sound like a MG that fits in here?

>> No.14146235

>>14146228
I bet Hellhounds would enjoy a nice sub sandwich. Good thinking, anon.

>> No.14146239
File: 269 KB, 539x800, 1438302446573.jpg [View same] [iqdb] [saucenao] [google]
14146239

SLIMES WEARING CLOTHES!

>> No.14146241

>>14146232
I read yuri manga, that doesn't make me putting my dick in a girl yuri. There's nothing wrong with reaming fujo MG's.

>> No.14146242

Anyone know any good buttstuff?

>> No.14146244
File: 782 KB, 5000x5000, 5000.jpg [View same] [iqdb] [saucenao] [google]
14146244

>>14146223
>Giant barbed dicks that hook into the vaginal walls of victims and prevent escape while litres of semen fill her womb up and break through tot he point that it breaks and floods her internal organs with stickiness

>> No.14146245

>>14146194
>he says, omitting this applies to every monstergirl
>also leaving out that thanks to the DL's energy being in every monstergirl, all MGs are quasi succubi

Come on buddy...

>inb4 I WASN'T TALKING ABOUT MGE

come on buuuuuuddy...

>> No.14146246
File: 441 KB, 950x1035, 1436206059094.png [View same] [iqdb] [saucenao] [google]
14146246

>>14146229
It's the weekend, and shitposters are posting bait within several posts of one-another.

>> No.14146249
File: 280 KB, 504x800, Slimefox.jpg [View same] [iqdb] [saucenao] [google]
14146249

>>14146239

>> No.14146251

The fuck is happening here.

>> No.14146253

It's amazing how hard you people can ruin a fetish.

>> No.14146255

>>14146245
The majority of monster girls are inherently evil. Just because you like them doesn't make it not evil.

>> No.14146256

>>14146241
>I read Yuri manga

Oh, I got rused. Well done.

>> No.14146257

>>14146251

Burn it all to the ground.

>> No.14146259
File: 653 KB, 566x800, Harpy.png [View same] [iqdb] [saucenao] [google]
14146259

>>14146251
A Storm of Some Sort

>> No.14146260

>>14146235
Now I'm stuck with the mental image of a mini Hellhound in a sub roll looking completely unamused.

>> No.14146262

>>14146260
Fund it.

>> No.14146263

>>14146260

I want to see this.

>> No.14146264

>>14146255
Are you done pretending to be retarded?

>> No.14146266

>>14146256
Not him but I love hardcore man x monster girl stuff and also enjoy reading cute yuri but keep them separate as can be.

I read yuri for cute and heart warming shit, I'd be the real monster to have that anywhere close to my fetish material.

>> No.14146268

>>14146260
Yeah that sounds fun, then you can spam that and drink maledomfag tears.

>> No.14146269

>>14146192
Might as well turn her into a sloppy mess then before she gets a shower and a trim.

>> No.14146271
File: 476 KB, 993x737, 27.png [View same] [iqdb] [saucenao] [google]
14146271

>>14146256
>rused
You're paranoid, bro.
Also nothing wrong with cute girls doing cute things.

>> No.14146273

Now that the dust is settled can we all agree that anal stuff is shit?

>> No.14146276

>>14146246
Why does all the Yeti art make them so small? I want to be tightly held in her arms and forced to listen to her soft breathing.When we can no longer wait, I want make love to her as she wraps her arms and legs around me.

>> No.14146277

>>14146098
Not when MAMONO MANA gets involved.

>> No.14146278

>>14146244
What the flying fuck are you talking about.

>> No.14146279

>>14146271
Unproductive.
Monster girls are for fucking only

>> No.14146281

>>14146260
Haha, sounds cute.

>> No.14146282

>>14146266
Not him either but, no one cares and /y/ and /u/ need to stay the fuck where they belong.

>> No.14146286

>>14146271
Fuck off.

>> No.14146290

>>14146282
That was sort of my point, there's a place for everything.

>> No.14146291

>>14146278
Spiky genitals like what some animals have scaled up to the size of being able to rape monster girls

>> No.14146292

>>14146273
Poop joke.

>> No.14146294

>>14146273
>>14146273
Why yes Anon, there is shit in anal.

>> No.14146295

>>14146273
>Not wanting to use tight assholes instead of the loose as fuck vagina

>> No.14146298

>>14146294
Not if you do it right.

>> No.14146299

>>14146295
Mamonomana makes them both tight though.

>> No.14146303

Which monstergirl likes it in the sds the most? Anubutts need not apply.

>> No.14146306
File: 21 KB, 640x640, 1437071073170.png [View same] [iqdb] [saucenao] [google]
14146306

>>14146299

>> No.14146311
File: 388 KB, 570x810, 8c3a0a782b777e545d1636b89eebe393.jpg [View same] [iqdb] [saucenao] [google]
14146311

>>14146295
>Not wanting the gentle caress of the vag instead of an anal death grip
Are you gonna say you don't like milfs next?

>> No.14146314

>>14146303
*ass

Phone Chan I'm going to slap the shit out of you.

>> No.14146315

>>14146311
Old hags are worst taste, along with fatfags and homos.

>> No.14146316

You know what would be terrible? Being forcibly married to a monster girl that has the complete opposite fetishes that you have.

>> No.14146317

>>14146175
I wanna challenge a Monoeye to a staring contest. If in win, I get to ruffle her hair in public like an older brother to his sister. If she wins...well, I don't know what'd she'd ask for.

>> No.14146318

>>14146303
I do not see why any monster would have a particular fondness for sodium dodecyl sulfate.

>> No.14146319

>>14146315
Delicious plump ara ara alps are the best!

>> No.14146320

>>14146311
>having a weak dick

The penis is a muscle, use it or lose it. Google iron penis.

>> No.14146321

>>14146318
Nah I think he meant small dick syndrome.

>> No.14146322
File: 216 KB, 1837x1200, 1436876759203.jpg [View same] [iqdb] [saucenao] [google]
14146322

Just as planned

>> No.14146323

>>14146319
Only if she has an ass so fat that it makes any underwear she wears a thong.

>> No.14146326

>>14146306
>Not posting Mucus Frog version
SUCH A LUST FOR ONE JOB

>> No.14146327

>>14146316
Her fetishes are baseline human males? Sounds like it would work.

>> No.14146331

>>14146323
>she
>girl
>female
>her
Pick none.

>> No.14146336

>>14146331
In this continuity Alps are female. Only in old myth stuff are they short ugly dudes.

>> No.14146337

>>14146317
If you win you can ruffle her hair. If she wins you MUST ruffle her hair. And call her c-c-cute.

Think you can handle those conditions?

>> No.14146340

Why is KC even making submissive monster girls? There is absolutely no point to them. He really should just rewrite them all to be dominant and continue down that path.

>> No.14146341

>>14146336
>transsexuals
>female

What'd I just say nigga.

>> No.14146342

>>14146323
Absolutely, but would you be willing to pound that fat alp ass?

>> No.14146343

Do not respond to shitstarters.

>> No.14146347

>>14146337
Bunny logic.

>> No.14146348

>>14145410
>Pick the little self insert
>Sexually bullied and molested by Zealot-chan the entire fight, until cum bar fills 99%
>"What, did you think I'd let you cum? Naughty little monster fetishests don't get to cum without permission. And I still think you need to be punishe for entering a tournament just to get fucked by monsters, slut."
>Bar resets
>The bullying continues.

>> No.14146349

>>14146342
Damn straight I would, it would be groped, spanked, and driven into so hard that it would bounce.

>> No.14146350

It's amazing how both sides of the alp arguments are just as fucking obnoxious and retarded.

>> No.14146351

>>14146341
MAGIC Transexuals
Plus they were already mentally female before that and just had a programmed body

>> No.14146354

>>14146347
Bunny logic would be popular in MGC.

>> No.14146357

>>14146350
You know, in any argument the most obnoxious person is the person who thinks they're superior for being neutral and rubs it in everyone's faces

>> No.14146358

>>14146351
DEnile isn't just a river in not!Egypt.

>> No.14146359
File: 127 KB, 636x900, 1429309465850.jpg [View same] [iqdb] [saucenao] [google]
14146359

>people are forcing Alps yet again
Just go with a normal Succubus you faggots.

>> No.14146360

>>14146337
>Not ruffling a Cyclops' hair while staring at her in the eye and maintaining direct eye contact as you call her cute
>Or how some day you're going to slip a wedding band onto her finger
>Or how you want to give her so many daughters that you'll have nine sons-in-law
>Or how you want to grow old and grey with her and snuggle in the autumn sunset with nice glasses of iced tea on your small table as you wrap each other in warm blankets
>Or how you want to hug the shit out of her for being so cute, right here and now

Do you even bully monoeyes

>> No.14146363

>>14146357
No I'd say the more obnoxious ones are the people who fucking fight for over an hour over this fucking bullshit.

>> No.14146366

SHUT THE FUCK UP

JUST SHUT THE FUCK UP ABOUT THIS FUCKING BULLSHIT YOU RETARDS

>> No.14146367

>>14146359
But how can anyone argue and shitpost by acting logically?

I want a non-killer succubus to visit me tonight

>> No.14146368

>>14146350
It's amazing how alps are still talked about.

>> No.14146369

>>14146363
No I'd say the more obnoxious ones are the people who say they're not involved and keep bragging to everyone about how they're not involved

>> No.14146372

>>14146348
>>Sexually bullied and molested by Zealot-chan
>Rough reacharound handjobs while seh haa-haa's in your ear like a maniac
YES

>> No.14146373

>>14146359
It is the only way for a human male to escape being human. Closest otherwise are undead made from multiple bodies and even then that isn't you.

>> No.14146374

>>14146359
No one forced Alps though, it came up naturally. Stop forcing your "use normal succubus instead of alps" meme.

>> No.14146375

>>14146348
Zealot chan is mean. MEAN!

>> No.14146377

>>14146360
All those other things were going to be a surprise. It wouldn't as much fun if she knew ALL of the things I was going to do to her while her head was in my hands and she was powerless to resist.

Do YOU even bully monoeyes? You don't want to give them prep time to steel their nerves.

>> No.14146378
File: 370 KB, 700x853, Ghost and Friend.png [View same] [iqdb] [saucenao] [google]
14146378

Spooky times come soon

>> No.14146382

>>14146378
Can't wait to spend another night indoors with my porch lights off.

>> No.14146385

>>14146369
So you're defending the people who start this bullshit every single fucking time and derail all discussion for fucking hours?

Legitimately kill yourself.

>> No.14146386

>>14146378
YURISHITTER GET OUT
REEEEEEEEEEEEEE

>> No.14146387

>>14146374
>not forced
>wasn't here for the bullying bullshit that started it all
>wasn't here for chubby alp sempai
>wasn't here for the faggots insisting every MG is an alp

Peddle your lies elsewhere.

>> No.14146388

>>14146378
Just wanna put my dick in that eye socket, if you know what I mean.

>> No.14146390

>>14146386
>Yuri
Anon, it's pretty clear those two are just friends who are going to go boy hunting together this Halloween.

>> No.14146391

>>14146386
I hate yuri as much as anyone, but that is clearly just cuteshit.

>> No.14146392

>>14146372
>Sits behind the character, hooks her legs over his, making him spread his legs
>Turns him to the panting crowd, his erection standing proud and tall
>Jerks him off while nibbling his ears, licking his neck and playing with his nipples
>"Hey what are you so embarrassed about? This is why you're here right? To show all your slutty self to this pack of monsters? If that's what you want, the least I can do, is do it myself, so none of these whores touch you. While you're in this ring, you're mine, understand? No one else's."

>> No.14146396

>>14146385
Monster girl fetish was a mistake. I wish I only watched shows and played video games about humans doing human things.

>> No.14146397
File: 39 KB, 261x358, 1441819015552.png [View same] [iqdb] [saucenao] [google]
14146397

>>14146386

>> No.14146398

>>14146387
What the fuck are you on about, I'm talking about this discussion right now, not shit that happened years ago

It started with >>14146315, and someone brought up alps as a joke response in >>14146319

Learn to follow the conversation retard.

>> No.14146401
File: 404 KB, 800x800, Ghost 04.png [View same] [iqdb] [saucenao] [google]
14146401

>>14146386
Look, A person who has little to no brain!

>> No.14146403
File: 43 KB, 321x450, MGES3d.jpg [View same] [iqdb] [saucenao] [google]
14146403

>>14142434
My strong suspicion is that we get the world we deserve. Also, it's just 'cos everyone waifus dragons and no-one waifus doppelgangers, so everyone clicks on the story called "Dragon" first.
> tfw

>> No.14146404

>>14146276
Those are Yeti kids, a full adult Yeti would likely have about 6 inches on you so she can wrap your whole body up when it's time for hugs

>> No.14146407
File: 672 KB, 824x1024, 49373604_p0.png [View same] [iqdb] [saucenao] [google]
14146407

Meow

>> No.14146408

>>14146404
Fuck off.

>> No.14146409

>>14146340
He writes for himself and a small circle of friends.

>> No.14146410

>>14146398
Doesn't mean alps are not forced. Also
>years ago

Try 1 year
6 months
A week ago

>> No.14146412

>>14146407
This is wrong

>> No.14146413

>>14146404
Yetis come in various heights anon.
Though I wouldn't say no to more fluff to cuddle.

>> No.14146415

>>14146401
Look, a ghost with little to no ass!

>> No.14146417

>>14146404
Lovely.
>>14146408
What's wrong with you?

>> No.14146418

>>14146407
> Legs kraken
Why do so many artists do this?
(I'm not even sure I dislike it, I just wonder why it seems to happen a lot)

>> No.14146419

So since maledomfags have had Kikimoras taken from then what do they have left? Kobolds?

God damn those faggots are more pathetic than cuckolds.

>> No.14146424

>>14146412
>>14146418
At least it exemplifies how MGE girls can polymorph.

>> No.14146426

>>14146418
How else would they move on land?

>> No.14146427

>>14146407
Kraken is drunk again.

>rubs against you like a cat trying to be cute
>her slimy body creeps you out
>tries doing that pawy shit cats do to show affection or explore
>end up with suction cup marks

>> No.14146429

>>14146419
Alices!

Until we manage to give those Alices some Wonderland cake and make them delicious chubby oneesans with a desire to dominate

>> No.14146431

>>14146419
Saltman pls stop.

>> No.14146432

>>14146392
Angry handjobs are the best. I want her to make me into her bullying slave that she keeps in the basement of the convent and slaps and jerks around for fun after work.

>> No.14146433 [SPOILER] 
File: 179 KB, 544x480, 1443307284417.gif [View same] [iqdb] [saucenao] [google]
14146433

Hello

>> No.14146435

>>14146433
your not real

>> No.14146436

>>14146433
Where are her eyestalks? Was she in an accident?

>> No.14146437

>>14146427
Throw it back into the sea

>> No.14146438

>>14146429
Why do you faggots have to ruin everything?

>> No.14146439

>>14146433
Afternoon
Shut up, I didn't spend a minute staring at it expecting something to happen. You have no proof!

>> No.14146440

Everyone above this post is being trolled.
Everyone below it will also be trolled.

>> No.14146442

>>14146337
>Call her cute in public
How depraved! This devious little girl talks big, but I'm not gonna lose!

>> No.14146445
File: 393 KB, 651x1200, Troll.jpg [View same] [iqdb] [saucenao] [google]
14146445

Hello, wanna foot job

>> No.14146447

>>14146438
>replying
>to a fishing pole

>> No.14146448

>>14146445
Can I fuck your thighs or tits instead? I'll pay extra.

>> No.14146450

>>14146432
>keeps in the basement of the convent and slaps and jerks around for fun after work.
>Comes in one day, wobbling, exhausted and drunk
>Glares at you, face twisted into a scowl
>Picks you up
>Throws you onto the bed
>Glowers down at you, swaying slightly in her intoxication. "Don't say a word. Got it?"
>Gets in bed with you and snuggles up close, her face buried in your chest, arms wrapped around you and her legs twisting through yours.
>Falls asleep almost instantly
>Watch as her scowl slips into a small, cute, content smile

>> No.14146451

>>14146445
No foot. Need sleep.

>> No.14146452

>>14146445
you will never purple nurple a troll while shouting this is for all her misdeeds on the interner

>> No.14146454

>>14146445
Fuck no. No hobs or gobs,no trolls or 'bolds, no boggies.

>> No.14146455

>>14146445
While sitting on my face? Deal?

>> No.14146456

>>14146445
What kind, rubbing my dick between 2 feet or me laying down and her gently stepping on it?

>> No.14146461

>>14146450
Sounds like somebody's gonna wake up with a hell of a hangover and her thigh gap glued together with cum!

>> No.14146464

Why do maledomfags even come here? Shouldn't MGU/MGR be more to their kind of thing?

>> No.14146465

>>14146456
>massaging your cum on the soles of her feet, tickling her
>Watching her slip and fall face first

HUE

>> No.14146471

>>14146445
I'm more into paizuri, intercrural , hot dogging. Having that big Troll ass firmly planted on my face would be fine too.

>> No.14146473

>>14146419
>>14146464
Come on dude.

>> No.14146474

>>14146433
>You'll never never have a Gazer childhood friend who you have to leave behind when you go to college.
>You'll never video chat with her every so often.
>You'll never come home after graduating only to find that she's thrown you a surprise party with all of your other friends and her friends too.
>She'll never choose to reveal that she has feelings for you at that party before semi-drunkenly mashing her lips against yours to the cheers of everyone in the room.
>You'll never wake up the next morning with her next to you with the biggest, dumbest grin on her face and an adoring look in her eye.

Damn it.

>> No.14146476

>>14146464
http://i.imgur.com/ZnK8DgH.png

>> No.14146480

>You'll never stalk Kunoichis with your trust ghillie suit and sniper rifle without ever being found by them
>You'll never have a sniper duel with the one kunoichi who actually finds you after years of successful scouting operations

>> No.14146484

>>14146480
trusty*

>> No.14146488

I want to see a Gazer DJ at a rave who uses her eyes as strobe lights.

>> No.14146490

Has KC ever covered what happens with men who get "married" to a monster girl he doesn't want anything to do with and doesn't suit any of his likes or fetishes? Is he just forced to stay with her in a shitty relationship?

>> No.14146491

>>14146480
>you will never beat the sniper kunoichi by dropping a supply box on her head

>> No.14146493

>>14146480
I want to see a Wendigo in a ghillie cloak.

>> No.14146496

>>14146480
Then you get caught and dominated yadda yadda yadda.

Fuck off.

>> No.14146501

>>14146491
>you will never trank, and eat her per parrot in front of her

>> No.14146503

>>14146490
The man's mind is altered so he likes her.

Your actual likes and dislikes don't matter, you are forced to like your new wife.

A man immune to metal effects is forcefully married to a monster he is utterly repulsed by, she wonders why he never smiles and assumes he's tsundere. In reality he hates her completely and just wants to escape.

>> No.14146504
File: 104 KB, 500x650, 1441405118002.png [View same] [iqdb] [saucenao] [google]
14146504

I will claim the final image for Haohi's glorious feet! May all be stepped on and enjoy their superiority!

>> No.14146506

>>14146496
Don't be a big baby, baby.

>> No.14146511

>>14146496
Fuck off yourself, holy shit.

Stop trying to start shit for fuck's sake.

>> No.14146513

>>14146480
>You'll never find out that she, too, is a battle sadomasochist who is turned on by fighting with you
>She will never be sopping wet to find someone who matches her in battle in both skill and enthusiasm

>> No.14146514

>>14146490
Yeah. Mamono mana changes her to suit him. Or it changes his tastes to suit her. No unhappiness in the hugbox!

>>14146461
Do you look after her, in a strange turn of events?
>She leaved you with a weeks supply of food and disappears, with a note saying that if you leave, she'll hunt you down. If you stay, she'll reward you
>She arrives in the dead of night a week later. Closes all the curtains, doors and windows, takes you down into the basement
>Her hands are cold
>"I'm hungry." She sits you down on the bed and climbs into your lap, wrapping her legs around you. "Don't move."
>She leans in and kisses your neck, and the confusion slips to panic when she bites down. Twin incisions of pain flare, and it's only her embrace that keeps you seated and stops you from thrashing in a panic.
>Go weak as she drains the blood from you.
>Once she's had her fill, you fall back on the bed, with her still straddling your hips, her eyes glowing a deep crimson, your erection poking up against her butt. Shoot her a confused look
>"What? I can't protect and punish you forever if I'm only going to get old and die."
I'm starting to want a zealot-turned vamp waifu who'll bully me.

>> No.14146515

>>14146504
Premature doesn't even touch it.

>> No.14146516

>>14146506
Fuck off, femdom is one of the most generic overused things in this shitty thread.

Absolutely ruins 99% of monsters thanks to femdomfags shitting their diapers whenever someone wants to imagine a normally dominant monster girl as a submissive one.

>> No.14146517

>>14146511
Report and ignore.

>> No.14146519

>>14146503
>>14146514
God damn MGE is terrible.

>> No.14146520
File: 606 KB, 1010x1050, 1441133819285.png [View same] [iqdb] [saucenao] [google]
14146520

Is Miia a cool snake? Is she waifu material?

>> No.14146522

>>14146520
No and no.

>> No.14146523
File: 233 KB, 465x336, 1366660882923.png [View same] [iqdb] [saucenao] [google]
14146523

>>14146516
You're trying too hard to be mad about something nobody cares about.
Relax and like what you like, bro.

>>14146520
Also, yes. Miia is cute, and sexy somehow at the same time.

>> No.14146524

>>14146516
Hey, it's cool man, only sub mostergirls are allowed to be portrayed as having an opposing personality to their description.

>> No.14146525

>>14146514
You keep your monstershit away from my Zealot Chan. Come up with your own stuff.

>> No.14146528
File: 31 KB, 225x350, 1407210147505.jpg [View same] [iqdb] [saucenao] [google]
14146528

>>14146504
This image is 294/301 you dingus, you were 292

>> No.14146530

>>14146474
Drunk Gazer sex, eye stalks wobbling everywhere.

>> No.14146531

>>14146490
KC will tell you that it usually doesn't happen.
The MGE will tell you that it doesn't matter, thanks to MAMONO MANA.

>> No.14146532
File: 453 KB, 866x720, 1439633891853.png [View same] [iqdb] [saucenao] [google]
14146532

>>14146520
How is she not?

>> No.14146533

>>14146514
>self-corruption just to yan a guy forever
Would she finally let me put it though her cold, dead hymen or will she keep teasing me with cold handjobs while she drains me nightly?

>> No.14146535

>>14146519
It's not great...

>> No.14146536

>>14146523
Oh yeah I really like this fucking furry since that's the only thing I can fucking talk about without starting a fucking shitstorm.

Totally fucking fine how one shitty little monster girl with one of the worst designs is the only sub girl I'm allowed to talk about, sure is fucking great.

>> No.14146537

>>14146516
>>14146496

Pay attention everyone, this guy right here is saying he wants to be banned. Let's give him a hand with that.

>> No.14146541
File: 341 KB, 1080x1920, 1436423686378.jpg [View same] [iqdb] [saucenao] [google]
14146541

https://www.youtube.com/watch?v=7CK0_bbcJgo
Would a Vampires castle that's the size of Castlevania have its own assorted monstergirl/human communities?

>> No.14146542

>>14146525
>Becoming old and feeble
>Can't love and protect and punish you anymore
What a shit Zealot. I guess her willpower wasn't eternal, huh? Weak. You call that devotion?

>>14146533
>Would she finally let me put it though her cold, dead hymen
I was under the impression she fucks you nearly every night, hoping you lean your lesson, but never really defining what the lesson was supposed to be.

>> No.14146544 [DELETED] 
File: 134 KB, 700x767, 1440487222772.jpg [View same] [iqdb] [saucenao] [google]
14146544

Pharaoh thighs to sit on your face would be nice, would they?

>> No.14146545

>>14146544
No.

>> No.14146546

>>14146536
>Only one sub
You're really grasping, bro.
You're telling me you don't like Alices? Kiki girls?
Cockatrices, even?

>> No.14146547
File: 1.37 MB, 1219x1354, 1442748922129.png [View same] [iqdb] [saucenao] [google]
14146547

I am Disappointed by all of you

>> No.14146553
File: 538 KB, 895x843, 1401727298905.png [View same] [iqdb] [saucenao] [google]
14146553

>>14146544
Wrapped chocolate thighs?
Fuck yeah.

>> No.14146554 [DELETED] 
File: 772 KB, 1200x1500, Foot.png [View same] [iqdb] [saucenao] [google]
14146554

Hail to the perfect Haohi and her perfect feet!

>> No.14146559

>>14146547
Oh senpai, if only I could tell you how little I care...

>> No.14146560

>>14146546
Alices are shit, Kiki's aren't subs anymore now and Cockatrices are fucking boring compared to everything else.

>> No.14146561

>>14146554
Haohi a shit.

>> No.14146562
File: 409 KB, 1664x1377, 1410503140790.jpg [View same] [iqdb] [saucenao] [google]
14146562

Last image for oni-chans everywhere.

>> No.14146563

>>14146546
I think he's forgetting those ACME-esque Cockatrice greentexts that were met with good reception.
Then again he's only here to shitpost, but whatever.

>> No.14146564
File: 3.18 MB, 2000x2500, 087405af52430522c33c49a80b33a3f1.png [View same] [iqdb] [saucenao] [google]
14146564

Cold grapesnakes

>> No.14146566

>>14146542
>she fucks you nearly every night
I thought it was repressed sexual bullying with no completion, otherwise how is it different from a yan waifu?

>> No.14146569
File: 252 KB, 600x839, 20932356_big_p0.jpg [View same] [iqdb] [saucenao] [google]
14146569

Eat shit.

>> No.14146571

>>14146553
I'm more interested in the girl in the bottom right corner.

>> No.14146572

>>14146546
We have way more subs than that.

Seems like it's time to update the list, again.

>> No.14146573
File: 772 KB, 1200x1500, Foot.png [View same] [iqdb] [saucenao] [google]
14146573

Haohi is cutest!

>> No.14146574

>>14146560
>Alices are shit
Really?
>Kikis aren't subs anymore now
4 U
>Cockatrices are boring
REALLY!?
What about holstaurs, then?
Everyone loves Holstaurs.

>> No.14146576

>>14146569
I can't tell if this is an alp or a flatccubus.

>> No.14146578

>>14146576
Stop forcing alps, it's a tomboy succubus.

>> No.14146579

>>14146566
Well I can't imagine that lasting any longer than a few months at most. But maybe that's just the limit of my imaginings. I ask you, then, how would she stop herself from straddling you and riding you into the morning, packing her womb full of your precious seed, feeling your warmth in her belly?

>> No.14146580

Thinking of writing about a monster girl breeding farm. Has anyone written about this before or something similar?

>> No.14146583

>>14146573
Haohi a fucking shit.
Stop trying to force her.

>> No.14146586

>>14146578
>Clearly pic of an alp
...Ok boss.

>> No.14146588

>>14146578
Don't you know where you are? Everything must be alps. Even if it doesn't look like one, it has to be an alp. The most forced girl in these threads.

>> No.14146591

>>14146576
Totally a succubus bro, she's only holding that male symbol close to her heart because that's how much she loves the cock.

She's safe, go for it.

>> No.14146593

>>14146580
The only thing I can think of is a guy getting thrown into a house of rare monstergirls and told to impregnate all of them as much as he can.

>> No.14146596

>>14146578
I'm not trying to force them, it just looks like the alp in the profile, but with a bikini.

>> No.14146600

>>14146573
You double posted this just to get last image. I'm disappointed in you anon.

>> No.14146601

>>14146574
Eh, they're okay I guess.

I'd rather have something like a submissive Minotaur but that's not allowed while shit like dominant Kobolds is absolutely allowed.

>> No.14146602

>>14146580
No. Go for it.

>> No.14146603

>>14146576
MGE Succubus has up-swept horns and Alp has forward-swept horns. This criterion obviously counts a lot of other Succubutts as Alps.

>> No.14146608

>>14146600
I don't care, I only need Haohi to step on me.

>> No.14146610

>>14146603
Anyone who tries to look for details like that when it's already been said that monstergirl appearances are not uniform deserves to sleep with an undercover alp.

>> No.14146611

Do MGs sniff out compatible mates (personality, fetishes, etc) or jump the first guy they see?

>> No.14146613

>>14146480
>>14146513
>No kunoichi to make feel alive again in the heat of battle
>No kunoichi to engage in rough hatesex with after nearly killing each other

>> No.14146615

>>14146610
What we need is a sort of Voight-Kampff test for Alps.

>> No.14146618

>>14146601
You complain too much, you know that, saltman?
Just like what you like.

>> No.14146624

>>14146611
I just imagined a Succubus taking a deep whiff of the air, pausing for a moment and then saying "I smell an Ass Man" while grinning.
Take responsibility for my sides.

>> No.14146625

>>14146608
>foot fetish
>liking .less' donut steel
I don't know which one disgusts me more.

>> No.14146626

>>14146610
Eh. I'd sleep with a completely upfront one too.

>> No.14146627

>>14146618
But what I like isn't allowed here while the polar opposite of what I like is.

It's complete horseshit.

>> No.14146629

>>14146624
Hellhound walks into a bar, "Which one of you has the bondage fetish?"

>> No.14146633

>>14146625
The only disgust I need is Haohi's, so she'll step on me like the worm I am! I want to lick her feet!

>> No.14146636

>>14146627
>people don't like what I like and sperg about it
And?

>> No.14146637

>>14146633
Is that you, fujoslave-kun?

>> No.14146638

>>14146627
>But what I like isn't
I would totally enjoy a little something about an Ushi-Oni who enjoyed a bit of shibari-play.
You know, like Rachnee, but with an Ushi-Oni

>> No.14146642

>>14146618
Are you fucking autistic or just replying to yourself? That guy bitches about people not letting him like what he likes every fucking chance he gets. When it's about maledom he gets really weepy and complains the mean femdomfags don't let him have fun. When he complains about femdom itself he posts in a really aggressive manner and how it's the worst thing since guru. FUCKING STOP REPLYING TO HIM! He isn't a dom. He isn't a sub. He's just a troll.

>> No.14146643

>>14146611
I hear Yeti's can smell a man's need for hugs from miles away. There's no shaking them once they have the scent.

>> No.14146644

>>14146637
No please, I have better tastes than that. Haohi isn't into fujoshit, she prefers gender bending, exhibitionism, and femdom.

>> No.14146645

>>14146629
"Sorry ma'am, I've already got a date with the Arachne in the corner."

>> No.14146646

>>14146633
Gross, please leave.

>> No.14146650

>>14146627
>what I like isn't allowed here while the polar opposite of what I like is
There is one guy up above trying to bait maledomfags. You just have a victim complex. Get over yourself, you pussy.

>> No.14146651

>>14146638
Only allowed if she's the dominant one.

>> No.14146652

>>14146603
>>14146610
Someone made a list addressing this but, fuck me if I'll find it right now.

>> No.14146653

>>14146642
Maybe if we bait him enough, he'll say something he shouldn't.
Was my thought process.

>> No.14146655

>>14146642
>He isn't a dom. He isn't a sub. He's just a troll.
really, this.

>> No.14146658

>>14146629
I'm liking this idea of monstergirls being able to smell who has fetishes that match their own.

>Wake up with a Vampire straddling you.
>"So, I smelled that you have a necking fetish. What a coincidence!"

>Kikimora busting into some guy's house in a latex maid outfit.
>"Does someone in here like tight clothing?"

>Lilim busts down a bar door
>"Alright, which one of you degenerates likes handholding?"

>> No.14146659

>>14146651
Wrong.
Rachnee in the manga is hugely worried about hurting people, and even likes tying herself up sometimes.
It can easily be explained as "Let's try tying me up this time, since otherwise, I might get carried away and can't hold myself back, and you might end up with a broken pelvis again."
It'd be cute, I'd read that if it's done right.

>> No.14146666

>>14146659
Sorry anon, it's just not allowed unless the guy is getting tied up and he has a broken pelvis by the end of it.

>> No.14146667

>>14146624
A succubus sneaks into guys room and slowly crawls into his bed. He is paralyzed in fear as she crawls up and alides herself on top of him. She puts her hands on his shoulders and leans in for a kiss, but stops right before reaching him. She freezes and sniffs the air. She jumps back and stumbles into the floor gagging. Her expression is filled with panic and fear. She takes a nearby chair and smashes the window and flies out into the distance never to return. Anon goes back to fapping to scat

>> No.14146668

>>14146638
Can ushi-onis even make thread? Or would they have to buy it from an arachne?

>> No.14146671

>>14146615
Elaborate.

>> No.14146672

>>14146658
>>Lilim busts down a bar door
>>"Alright, which one of you degenerates likes handholding?"
*Slowly raises hand*

>> No.14146677

>>14146667
My sides

>> No.14146678

>>14146668
I mean, they're spiders. If they can't make thread, then the fuck's up with that?

>>14146666
Shut it, Super Satan. I have had it up to here with your lies.

>> No.14146679

>>14146672
>Everyone in the room raises their hand
>Except that one guy in the corner
>Alp walks in, uninterested and with a cigarette in her mouth
>"Alright, who here is the one with the Gender Bending fetish"
>Final hand is raised

>> No.14146680
File: 2.11 MB, 1060x1500, 4e88618ade451aa4da63dc3be55997d0.png [View same] [iqdb] [saucenao] [google]
14146680

I have the upper hand.

>> No.14146682

I know we're talking about fetishes but I had to leave when I had a random thought so...

Mindflayer tries to mindflay Wade Wilson. What happens?

>> No.14146683

>>14146678
Aren't there certain types of spiders that can't make silk?

>> No.14146684

>>14146658
>>Kikimora busting into some guy's house in a latex maid outfit.
>>"Does someone in here like tight clothing?"
ayyy that's me.

>> No.14146685

>>14146682
she bursts into flames?

>> No.14146686
File: 772 KB, 1200x1500, Foot.png [View same] [iqdb] [saucenao] [google]
14146686

Not so fast!

>> No.14146688

>>14146682
Mindflayer pulls out after half a second and says he's got the filthiest mind she's ever seen.
Also because he's taken by Death.

>> No.14146689

>>14146678
>lies

But it's true.

>> No.14146692

>>14146686
You fucking faggot.

>> No.14146693

>>14146680
>those tits and thighs
Sweating Man.jpg
>angel/demon/witch
QUE?

>> No.14146695

>>14146683
From the profile:
>At that time, if they find a man who strikes their fancy, they’ll shoot out webbing that is almost like a rope
So I suppose they can.

Also, any spiders that can't make silk aren't spiders. They are liars.

>> No.14146696

>>14146682
She does jack shit as you can't flay a mind that's already been shredded beyond all logic.

>> No.14146698

>>14146689
Begone from here, Satan.
We liked monstergirls before you did.

>> No.14146705

>>14146688
>Wade and Death sharing an ice cream in an undead city.

The undead MG's don't know if they should bow or run away because she might have come for them again.

>> No.14146706

>>14146672
You were the first one to raise your hand, she'd probably take you.
And then it's passionate sex while she holds your hands for the rest of the night.
With kisses and cuddling afterwards.

>> No.14146707

>>14146698
I'm still right, monster girls aren't allowed to be on the submissive end of sex no matter what.

It's just not allowed.

>> No.14146710

>>14146686
>>14146573
>>14146554
Made me laugh but I gotta tell you to stop, sorry.

>> No.14146712

Where would you go for a blind date with a monster girl?

>> No.14146713

>>14146707
Says you?

>> No.14146716

Purple dragons and their psychodelic gas are shit

>> No.14146717

So, we're at image limit, how much longer do you guys suspect it'll be till new thread?

>> No.14146718

>>14146712
Blind date? Oh jeez.
My favorite burger joint.
Can't ever go wrong with food for a first time.

>> No.14146722

>>14146713
Says almost every single anon in this thread.

>> No.14146723

>>14146707
I'm not sure what side are you trying to bait.

>> No.14146726

>>14146712
Five Guys.
They make great food, and there's one near me that's right next to a movie theater.
We can eat and then go watch a movie if we want to.

>> No.14146727

>>14146717
Well let's see here. We're 13 away from falling off, carry the two, minus the one, divide by the square root of quantum Wurm physics
I'd say two days(?)

>> No.14146730

>>14146722
Just you, I'm sure.
You can't tell me what to do. I like my Ushi-Onis.

>> No.14146733

>>14146712
Five Guys, Steak n' Shake, Buffalo Wild Wings, and if we're in the mood for a movie, Alamo Drafthouse.

>> No.14146736

>>14146713
Don't reply to obvious bait.

>> No.14146743

>>14146717
I'd say a few hours, but it's hard to say how many because it can vary.

>> No.14146745

>>14146717
Two more shitstorms.

>> No.14146746

>>14146679
>Ushi-Oni bursts into a gym
>"Which one of you fuckers has the bondage fetish?"
>Three hours and a nice dinner later she's down in her basement with her new boyfriend.
>She's wearing a leather bikini and is hanging safely from the ceiling from mythril chains.
>"Ah~ I never thought I'd find a human who likes binding girls up~"
>"Anon! Punish this filthy deviant who loves being taken advantage of~
>Meanwhile anon has the weirdest boner.

Would you?

>> No.14146753

>somebody's bumping old threads to the top

Please let people get the shitstorming out of their systems first or it's just going to spill over into the new thread too.

>> No.14146754

Would you love your waifu even if she had lots of scars from her days as a soldier/delinquent/fighter/whatever?

>> No.14146755

>>14146746
No because I don't like bondage and I don't like Ushis that are shit.

>> No.14146756

>>14146718
Roulette says your date is a Unicorn. She's an herbivore, but I'm sure she'd be okay with something simple like a salad or a milkshake.

>>14146726
Roulette says your date is an Arch Imp. No doubt she'll appreciate a good burger and fries, as well as a movie. Just don't be surprised if she starts molesting you in the dark theater and magics in single frames of her blowing you into the film.

>>14146733
Roulette says your date is a Lich. Being undead, she might pass on the food, but she'd probably be very interested in watching you eat and gauging your reactions. A movie is always a good choice, but don't be surprised if she asks to see a documentary.

>> No.14146757

>>14146736
I'm trying not to, but goddamn, we won't get banned.

>> No.14146761

>>14146746
Change it with a jorougumo or arachne and I might fuck a spider.

>> No.14146762

>>14146754
You bet. I would even kiss them to make sure she knew I liked her body.

>> No.14146766

>>14146746
>sub Ushi-Oni
Hell no I'll pass.

>> No.14146772

>>14146712
>>14146756
I think it'd be fun to go to the Aquarium, followed by going out to the docks and having a nice lunch I packed for the both of us out there while we watch the ships come and go. It wouldn't be fancy, but it'd be fun and relaxing, and I'd hope she'd like it! I'll make sure the lunch is something nice and cute, like those octopus hot dogs, and a chocolate chip cookie with a smiley face on it made out of chocolate chips!

>> No.14146776

>>14146746
I'd go for it.
>Halfway in, she'd be down for you removing her seal
>You tell her you probably shouldn't, but she insists you do so, to make her feel good
>Because of the chains, she can't rape you into oblivion the way she subconsciously wants to, now that her seal is off
>She instead settles for pedipalp leg-locking you and giving you tons of french kisses.
Oh yes.

>> No.14146777

>>14146746
I can get behind this.

>> No.14146779

>>14146757
*he, I mean.

>> No.14146781

>>14146746
No

>> No.14146782

>>14146756
>Roulette says your date is a Lich. Being undead, she might pass on the food,

Screw that, she's going to feel the hot juices of grilled beef rolling down her chin while slightly drunk on a mixed drink as I teach her what it means to truly live.

>> No.14146790

>>14146761
Okay then, instead of an Ushi imagine an Arachne, completely bound and wearing nothing but a leather tube top and a blindfold with her tongue lolling out of her mouth as she pants and begs you to shove your dick into her mouth and ravage it as you please.
Or maybe you'd rather have your way with her tits? Or even steal away her precious virginity? She'll do anything you want anon, all you have to do in return is give her your love.

>> No.14146791

>>14145334
There's absolutely no problem with it as long as you marry her first.

>> No.14146793

>>14146746
>Sub Ushi
>Ushi not being a rapetrain

Fucking faggots.

>> No.14146794

>>14146776
What would happen if you pulled out your dick and put it within sucking distance?

>> No.14146798

>>14146680
a well deserved victory

>> No.14146799

>>14146790
You had me at leather.

>> No.14146800

>>14146746
Hey Ushi I think you got the wrong door, the leather club's two blocks down

>> No.14146801

>>14146772
Roulette says your date is a mothman. She'd love looking at the tanks full of exotic fish, although she might forget about the glass, and bump into a few tanks. She'll hover around the docks, occasionally doing a few tricks to impress you. The homemade lunch is a good idea, but be sure to breathe through a napkin, cause she'll be shedding a lot of scales after seeing how much care you put in.

>> No.14146802

>>14146746
This is how threadcanons start. There's even an image already.

>> No.14146806

>>14146793
I'll write what I want anon, Monstergirls aren't just one kind y'know.
Submissive, Dominant, it's just more fodder for interesting ideas.

>> No.14146807

>>14146746
>>14146679
>>14146672
>Letting other people know about your fetishes

Normans git out

>> No.14146808

>>14146793
I can see the pole anon.

I'm not supposed to see the pole.

>> No.14146809

>>14146794
The entire time she eggs you on, talking about how if you don't rape her then and there, she might break you trying to satisfy herself later. You better hurry and make her feel good, etc.
Of course, if you don't, she'll end up trying to shake out of her chains in order to enjoy more of you however she can.

>> No.14146810

>>14146802
>"I'LL FUCK YOU"

>> No.14146811

>>14146808
He's not wrong though.

>> No.14146816

>>14146809
If you just stuck your dick in her mouth, would she just wait for you to thrust, or would she give you the most furious blowjob of your life?

>> No.14146817

>>14146806
>Monstergirls aren't just one kind y'know.
But they are though.

>> No.14146818

>>14146816
>or would she give you the most furious blowjob of your life?
Yes.

>> No.14146819

>>14146811
>he

>> No.14146821

>>14146811
>people can't like "dom" MGs being made subs

I love the smell of hot opinions and hypocrisy. You know you're proving that sperg from earlier right, right?

>> No.14146826

>>14146806
Anon, I suggest you ignore that faggot and keep doing what you were doing.

>> No.14146831

>>14146826
That was the plan.

>> No.14146835

>>14146818
Which MG would grapefruit her husband?

https://www.youtube.com/watch?v=Lvqhb_bUmIs

>> No.14146839

>>14146835
Please no.

>> No.14146843

>>14146819
>>14146821
Ah yes, I forgot, only one person can be against the thread turning their favorite monstergirl into a dickslave.

But don't worry, I'm not going to complain anymore since I'm not the guy from earlier and I don't like shitstorms.

>> No.14146844

>>14146835
What the fuck am I looking at?

>> No.14146845

>>14146712
Would be cool to rent a few bikes, ride around downtown and end up at a chill bar with live music.

>> No.14146846

>>14146821
>Implying it's definitely not some dude who complais about what he wants, then when someone delivers, falseflags like a bitch
It's so easy.

>> No.14146850

>>14146835
Probably some Barometz or Alraune.

>> No.14146852

>>14146712
I'd like to go speed-dating with Monster Girls.

>> No.14146853

>>14146843
>into a dickslave
That's not how I see it.
I like Ushi-Onis too, but I figured it'd be an interesting dynamic between her and a guy she loves.
Imagine an Ushi-Oni who hurt someone really bad in the past, and tries to practice shibari to prevent herself from hurting her mate in the future.
She wouldn't be a dickslave as much as loving, loyal best girl material.

>> No.14146857

>>14146843
>d-don't like what I don't like
Good, cause I'm not interested in your opinion anyway.

>> No.14146863

>>14146845
Roulette says your date is a mummy. Bike riding may not have been the best choice. There's a good chance she'll get her bandages caught in the chains. All the same, she'd probably enjoy some time at the bar, especially if there's music. Prepare to see a few ancient Egyptian dance moves.

>> No.14146866

>>14146857
There's no need for abrasiveness over fetishes.

>> No.14146871

>>14146863
>ancient egyptian dance moves
I want to walk in on a mummy doing some dorky dance to https://youtu.be/12CeaxLiMgE and embarrass her.

>> No.14146872

>>14146853
Yeah, she seems like the kind of girl who would come barging through a door screaming "WHERE'S MY DARLING?" if you were ever kidnapped.

>> No.14146873

>>14146863
Poor Mummy-chan.

>> No.14146875

Leglocking Loli Lilim

>> No.14146880

>>14146872
And THAT is what makes her best girl.

>> No.14146885

>>14146853
DON'T. REPLY.

YOU LITERALLY. HAVE TO DO. N-O-T-H-I-N-G.

>> No.14146891

Is being thrown into a matango pit the worst punishment possible?

>> No.14146897

>>14146863
I want to buy her comfortable cloth bandages that look fashionable, then smile as she strikes poses in the mirror.

>> No.14146898

>>14146891
Not really, you'll be eternally happy. However much of your braincells you'll have left will be happy, anyways.

>> No.14146899

>>14145528
I dont think he wold attract any monster
maybe one of the bullying types that want to break him.

>> No.14146900

>>14146885
I was not baiting. You're paranoid m8

>> No.14146903

>>14146891
No, being thrown in here is.

>> No.14146907

Uh oh Anon.

The daughteru you sent out to get pizza brought back one that is cheese only

How do you react?

>> No.14146911

>>14146907
Is this supposed to be a problem?

>> No.14146913

>>14146707
Obvious bait, but I'm bored so what the hell.

You mean like the little ushi story where she ends up as a sub at the end of it when they finally fuck? Yes, the thread imploded, fire rained from the skies, cats and dogs...oh wait, none of that happened. Nobody complained.

Maybe you should just fuck off?

>> No.14146914

>>14146907
Like a rational human being and just eat the pizza anyways.

>> No.14146915

>>14146907
I am totally fine with this. Cheese only isn't bad. Not my favorite, but still pretty good.

>> No.14146918

>>14146907
What's the problem? Sure, other stuff would be better, but you can't complain about a base pizza, since it's still pizza.

>> No.14146920

>>14146707
Maledom fags need to go somewhere else with their rape fantasies tbh.

>> No.14146922

>>14146712
The arcade, then dinner and a movie.

>> No.14146923

>>14146911
Yes it is!
Cheese pizza is disappointment in pizza form!
Pepperoni/Jalepeno is the best.

>> No.14146924

>>14146907
Send her ass back and tell her if she fucks up again no pizza and no dick for two weeks.

>> No.14146925

>>14146907
Confiscate the shota porn she brought.

>> No.14146926

>>14146907
That's fine. I'm mussarela main.

She gets headpats for bringing it home without eating a slice.

>> No.14146930

>>14146923
>He doesn't like straight cheese pizza
Cheese pizza is the gateway to all types of pizza. It is the bridge to all pizza life, eternal.

>> No.14146931

>>14146891
Would monstergirls aggressively use weaponized matango spores to obtain mindless loyal cumpumps?

>> No.14146932

>>14146712
I'd take them camping and fuck under the stars

>> No.14146933

>>14146746
Yes, with the force of a freight train.

I don't usually like bondage but hard masochist girls turn me on anyways.

>> No.14146935

What about a proud Centaur that is ashamed of her horse pussy?

>> No.14146936

>>14146930
Does it at least have sauce on it?

>> No.14146937

>>14139125
Im torn. On the one hand im curious what thats actually about that could make it go on for so long, on the other hand no way in hell im reading it to find out.

>> No.14146938

>>14146930
Please, pepperoni is the start of all things.

>> No.14146939

>>14146920
Good luck with that.

>> No.14146942

>>14146936
Yes?

>> No.14146944

>>14146935
Time to make a frontgina. Hell, I'll give her human legs if she asks.

>> No.14146946

>>14146907
By eating it. Cheese Pizza is fucking great. Grab a crusher and squirt some garlic onto it. Delicious.

>> No.14146947

>>14146707
>monster girls aren't allowed to be on the submissive end of sex no matter what.
Okay, that's cool, I'll just be over with this Alice and Kobold

>> No.14146952

>>14146777
that'stheplan.jpg

>> No.14146953

>>14146938
Pepperoni is the bridge to all types of meaty pizzas. But to get to Peperroni one must start with cheese
Cheese pizza is the lifeforce of all pizzas

>> No.14146956

>>14146947
Have fun with some one the shittiest monster girls in all of MGE.

>> No.14146957

Myrmecoleons need love too

>> No.14146961

>>14146907
Eating pizza with big meaty paws would present a problem. A knife and fork would be required to avoid getting her fur all cheese and sauced up.

>> No.14146962

Would you ever cuck a monstergirl?

>> No.14146963

>>14146956
Hey!
Kobold isn't that bad!

Especially when you sneak some holst milk into their cookies.

>> No.14146964

>>14146947
>Alice and Kobold
Not like anyone's going to have a problem with this.

>> No.14146966

>>14146956
You take that back, Alices are adorable.

>> No.14146968

>>14146962
No, because I'm not shit-tier.

>> No.14146970

>>14146961
>Eating Pizza
>With a knife and fork
There is nothing she can do. She has to deal with me giving her the most judging look I can ever muster while she eats her slice

>> No.14146971

>>14146922
Roulette says your date is an Amazoness. She'll probably challenge you to a few rounds of fighting games, and show you her favorite diner. No doubt she'll insist on paying for the meal. Expect a standard blockbuster action movie, and for her to wrap her arm around you after a conspicuous yawn.

>>14146932
Roulette says your date is a Ryu. She'll be excited to get out of the temple for a while, no doubt she'll ensure decent weather for the camping trip, marveling at nature's beauty. She'd probably be delighted to spend the night with you under the stars, just watch out for her reverse scale.

>> No.14146973

>>14146963
>Kobolds
>Good

Whatever you say, maledomfag.

>> No.14146974

Can someone explain to me the type of feet kikimori have? Do they have like harpy chicken feet or is it some sort of autistic shoe foot thing?

>> No.14146976

>>14146935
Yes.

>>14146944
That ruins the moe though. You've gotta fuck her right in her disgusting animal hole to get the most out of it.

I personally prefer hooved biped designs to 'taurs.

>> No.14146978

Who wants to bet this is Salt-kun trying to stir shit again?

>> No.14146979

>>14146712
I take her to the zoo, to see her parents!

>> No.14146980

>>14146968
What if she asked? what if cuckqueaning is what got her off?

>> No.14146981

>>14146973
Easy there Anon.
People may begin to think I'm not a switch.

>> No.14146982

>>14146907
>bathing the daugteru in pizza sauce and licking her clean

IT'S NOT MY FAULT
IT'S IN GOD'S PLAN
HE MADE A BONER SO MUCH STRONGER THAN A MAN

>> No.14146984

>>14146962
Probably a Beelzebub since she gets off to it, but it's more going to be her pimping me out to some thirsty bitches and then making me cum three times for every instance in which the others made me cum once.

>> No.14146985

>>14146973
>Claims to want to like things
>Doesn't like things

>> No.14146986

>>14146973
Cry more, bait-kun.

>> No.14146988

>>14146971
>Amazoness
Huh. She isn't really on my radar but that actually sounds like a good time. This might work out.

>> No.14146989

>>14146982
Great Scott what is wrong with you

>> No.14146990

>>14146978
He's easy to recognize. So yes.

>> No.14146991

>>14146980
Pretty sure she wouldn't because she's not shit-tier either.
Cucking is for the lowest of degenerates.

>> No.14146992

>>14146976
>ruins the moe

Does this look like the face of giving fucks and fucking animals?

>> No.14146995

>>14146982
In london its almost 2 AM, I do not need a perverted version of my favourite disney song right now

>> No.14146997

>>14146978
That isn't worth a bet, Anon.
It's pretty obvious.

>> No.14146998

>>14146979
Roulette says your date is a Large Mouse. She'll have a great time at the zoo, looking at all the different animal exhibits. It might be difficult to find an exhibit on mice, although there's probably a few scurrying around the grounds. Most of the time she'll probably just keep asking you for snacks.

>> No.14146999

>>14146982
YEAST INFECTIONS

>> No.14147000

>>14146989
>not molding your daughter to your liking and showing her all types of love

What's wrong with YOU?

>> No.14147002

>>14146712
Hanging out the house, marathoning that one TV show she's been meaning to watch but hasn't had the time to, and ordering subs for dinner.

>> No.14147003

>>14146998
>Most of the time she'll probably just keep asking you for snacks.
What is she? My daughter? I guess we can get ice cream, then go see the big cats.

>> No.14147004

>>14146712
Movies, maybe on a hike or a park.

After that maybe to a restaurant she likes so I know what kind of food she prefers.

>> No.14147005

>>14146999
MAMONO MANA

>>14146712
DUNE, MOTHERFUCKING BUGGIES!

>> No.14147006

>>14146978
I mean, I could bet money.
But then I'd be cheating.

>> No.14147007

>>14146991
>2015
>being so insecure you can't share your loved one without getting jealous

fucking manbabies shm tbh

>> No.14147011

>>14146712
Fancy restaurant to have dinner, then depending on the mood we go to a more quiet place or not

>> No.14147015

>>14147007
>being a cuck, ever
Good goy.

>> No.14147017

>>14146995
What song is that?

>> No.14147018

>>14147007
Ah, you're a funny guy.
You'll go in the matango pits last.

>> No.14147039

>>14147018
Sorry boss.
That pit's full.

We can toss him in the kobold pit though.

>> No.14147043

>>14147017
"Hellfire" from the hunchback of notre dame
to sum up the song
>God, let me have this woman or let me set her on fire

>> No.14147051

>>14147039
>trying this hard
Kobolds are lovely girls, and loving girls.
Unless you're talking about EMG Kobolds, in which case they are not.

>> No.14147052

>>14147043
Hue

https://www.youtube.com/watch?v=Zlyvcti3kQU

>> No.14147058

>>14147051
Nah, I know they're sweet girls, it's just that we have no other pits to toss that guy in.

Unless we want to give the portly gazer pit a shot.

>> No.14147060

A few threads back someone asked for a complete set of MGE profiles.

I've just finished updating them with the recent revisions from the fansite so here it goes if anyone needs it:
http://www.mediafire.com/download/7l289w5xa08y97q/MGE.zip
Going in chronological order.

>> No.14147064

>>14147039
>kobold pit
Explain further.
How would one go about getting thrown in this pit? I need to know lest I err from ignorance.

>> No.14147066

>>14147043
To be fair, that song was already kinda perverted.
To sum it up in more detail
>God, I'm a priest (which means I should be above the common sexual desires of normal people) but I want to fuck this girl, if she doesn't let me have her please cast her into hell to burn forever as a punishment for making me lust over her
You know! For kids!

>> No.14147067

>>14146907
Split it with her. Sometimes cheese is fine too.

>> No.14147068

>>14147060
There's one on the Panda
Profiles I mean

>> No.14147069

>You will never marry a Vampire and publicly have a very professional relationship
>She'll never cuddle you like a daki and be overbearingly affectionate behind closed doors
>You'll never give her a daughter, which changes her and makes her just as affectionate in public as she is in private

>> No.14147073

>>14147064
Current crimes include extreme Jaywalking, maliscious defacement of a cherry tree, and attempting to assassinate the head chef of the queen's viceroy.

>> No.14147077

>>14147002
Roulette says your date is a sea slime. Hopefully you've got a laptop or something to bring to the bathtub she'll be soaking in. It's hard to say what kind of TV show she might be into, but probably something that reminds her of the ocean.

>>14147004
Roulette says your date is an alarune. A hike might be not be doable, but she'd probably show you around her little area of the forest. If you brought something to watch a movie on, she'd be delighted, since she obviously can't get to the theaters very often. A restaurant is a no go, but if you offered, she'd probably love a bottle of filtered water. She might even send you home with some nectar as a gift.

>>14147005
Roulette says your date is a mantis. She might not see the point of driving over the sandy dunes, and it will be damn near impossible to tell if she's actually enjoying herself. But if she had a good time, she'll probably make it clear by asking for another date.

>>14147011
Roulette says your date is a scylla. Expect her to show up in a classy, buy very low cut dress. She'll find a place with great seafood. She seems innocent, but expect a few roaming tentacles under the table. No doubt she'd be delighted to take the date to a more private setting and wrap you up for a night of passion.

>> No.14147080

>>14147066
>every single kid's story not being dark as fuck
>MFW little red riding hood was about rape
>mfw in some versions she's a cannibal and devil worshipper

>> No.14147085

>>14147066
hey, this was old disney, where fucked up shit was the norm.
and if not that, casual racism

>> No.14147088

>>14147077
>alarune

Well this is shit.

>> No.14147089

>>14147069
>Your Waifu will never hold you close and take huge whiffs of your hair while she's cuddling you.
>You'll never make sure to buy shampoo that's scented like something she likes.

What scent would you get for her anons?
It can be literally anything.

>> No.14147090

>>14146935
>>14146944
>You'll never be able to give human legs to a centaur girl through magic
>You'll never help her adapt to walking on two legs as she clings to you, afraid that she might fall, as her legs tremble incessantly, like a newborn baby deer who can hardly walk yet

My heart would explode.

>> No.14147093

>>14147080
I am genuinely interested so you need to send me a link explaining that.

>> No.14147094

>>14147089
Someone like that would probably be the one buying your soap, shampoo and deodorant just to ensure that it's perfect.
Some people might think that's too controlling, but personally I really don't care as long as I'm clean when I get out of the shower. Only thing I'm picky about is toothpaste.

>> No.14147095

>>14147090
I just hope the magic doesn't backfite and give her a horse head along with human legs.

>> No.14147096

>>14147088
I'll take her if you want

>> No.14147097

>>14147060
Nice.
I needed this.

>> No.14147100

>>14147096
Yeah sure, I don't want her at all.

>> No.14147102

>>14147068
Yup, two of them. But both with wrong/incomplete TLs of the oldest profiles.

>> No.14147104

>>14147080
There's some pretty fucked up shit in old fairy tales, but up to this point Disney had never (and probably will never again) put so much blatant sexual and religious imagery and references in a song.
>>14147085
It wasn't that old. Hunchback was released in 1996.
>>14147093
Something something her red hood represents her hymen, the wolf represents a pervert leading her astray from the path of innocence.

Anyways, on a different subject:
>you will never have your Dark Priest waifu sing you https://www.youtube.com/watch?v=-NP-RsRGzVo to seduce you

>> No.14147107

>>14147094
Okay, now that's just a completely different breed of cute.
I'm just imagining her bringing you into the bath with her and carefully scrubbing your hair and body.

>> No.14147108

>>14147080
Christians were pretty /d/.
>"A-and then the wolf took her, and she moaned like a bitch on his knot, his demon seed filling her as she pledged her soul to satan"
>"O-oh, but that's bad! Yeah, bad heretic. P-praise Jesus. I totally didn't make this story up only because I thought it was hot. Just showing you how depraved the devil worshipers are."

The whole tale of Sodom and Gomorrah was just a fapfic disguised as a cautionary tale.

>> No.14147110

>>14147104
>the wolf represents a pervert leading her astray from the path of innocence.

Does that mean he raped her bedridden grandma? Cause he'd have to be one hell of a perv for that.

>> No.14147111

>>14147102
Don't they have the new ones? Mine does

>> No.14147112

>>14147089
The plainest soaps and shampoos I can find. Something unscented and hypoallergenic. That's best for scent fetishists. I know because reasons.

>> No.14147115

So Anons, the blood moon is almost upon us.

Are you ready for your waifu to, in addition to her increased libido, go a little bit feral?

>> No.14147117

>>14147110
To that I respond simply with this.
http://www.dailymotion.com/video/x262srt_tex-avery-mgm-1943-05-08-red-hot-riding-hood_fun

>> No.14147118

>>14147104
Jeez, he's got an awesome singing voice.
Disney villain songs are fucking awesome.

>> No.14147119

>>14147115
Wait, there's a blood moon tonight?
I am severely unprepared

>> No.14147120

>>14147110
>tfw no buff, busty Werewolf to lead you away from the path of innocence

>> No.14147121

>>14147115
>feral titty-fairy
Alright, this should be entertaining.

>> No.14147122

>>14147093
Google is your friend. It was children's lit that taught me the world of wonder I grew up in is a lie.

>> No.14147123

>>14147108
Lot's a prick
>you cant have sex with my guests, take my daughters instead
and then after the city's get destroyed and his wife gets turned to salt, his daughters get him drunk and fuck him.

>> No.14147124

>>14147118
Friends on the Other Side is one of the best Disney villain songs out there.
Voodoo-themed monster girl when? KC could probably make a cool design out of that.

>> No.14147125

>>14147121
You say that but she's going to get into pain play with a smile.

>> No.14147127

...Что это за место? Я помню тянут в небо какой-то воздушный шар ... это рай? Могу ли я мертв?

>> No.14147128

>>14147115
How goes a vampire feral? She's a dom already

>> No.14147130

>>14147128
More blood play
Lots of bite play

>> No.14147132

>>14146643
Their antennae act as radar, they can detect a trembling traveler anywhere on the mountain

>> No.14147135

>>14147127
>Могу ли я мертв?
Nyet.

>> No.14147136

>>14147124
Hey, any song sung by Keith David is pretty sick. Dude's got an awesome voice.

I wonder how monstergirls would react to watching some of Disney's best movies.
Pixar is saved for if they really want to cry.
Just not Cars. Cars is shite.

>> No.14147138

>>14147128
http://i.imgur.com/1bVW5WP.jpg

>> No.14147139

>>14147128
A more aggressive dom.
lots of nibbling.

>> No.14147140

>>14147130
>You'll never take a chunk of garlic on the blood moon as kiss your waifu, pushing it into her mouth and making her swallow it then waiting for her to go feral on you.

>> No.14147141

>>14147138
Hi there miss. How can I help you?

>> No.14147142

>>14147127
No, Anon - this isn't heaven, it's the other one.
Enjoy your stay, because you're here forever.

>> No.14147143

>>14147127
>...Что это за место? Я помню тянут в небо какой-то воздушный шар ... это рай? Могу ли я мертв?
Nigga you got fultoned.

>> No.14147144

>>14147128
>dom

Maybe if you're human and have no garlic handy.

>> No.14147148

>>14146712

A sushi place. And then maybe playing some video games together afterwards if she's interested.

>> No.14147149

>>14147136
>Pixar is saved for if they really want to cry.
>Ending to TS3
Fuck, no I didn't cry. There was an accident at the popcorn machine and the sprinklers kicked in

>> No.14147150

>>14147143
We really need to do that interpreter side operation

>> No.14147151

>>14147144
>Maybe if you're human
So what are you

>> No.14147152

>>14147138
B E S T
E
S
T

>> No.14147154

>>14147144
>smirkingvampirewringinghands.gif[1].jpg
Yes, boyim. Vampires are weak to garlic. show her what a man you are by feeding her some and dominating her with the dick. then you can dom her all you like, she'll be your cockslave.

>> No.14147155

>>14147151
Meat Popsicle

>> No.14147156

>>14147149
There's nothing wrong with crying at Toy Story anon.
I cried at the incinerator scene too.

>> No.14147158

>>14147151
What I'm getting at, is that if you're an incubus, vampire being dom isn't a must. Or if you're gud.

>> No.14147160

>>14147136
>your dullahan waifu makes you put on Darby O'Gill and the Little People every movie night
>whenever your skeleton waifu watches The Nightmare Before Christmas, your Krampus neighbor comes over to watch the montage of Christmas getting ruined

Also, one of the upcoming Pixar movies has a lot of elements of Polynesian mythology in it. Has KC ever done anything from the myths of that corner of the world?

>> No.14147161

>>14147144
>muh garlic
Yes anon we know KC likes to pander to everyone

>> No.14147162

>>14147154
Yes, that can happen. Do you like stating the obvious?

>> No.14147164

>>14147156
Don't remind me of the scene man. Just don't
Fuck

>> No.14147165

>>14147154
>>14147161
Fuck off.

>> No.14147167

>>14147115
>alpha Werewolf
>going super aggressive due to the blood moon

Its a good thing she isn't real, because I'd be dead.

>>14147120
True suffering.

>> No.14147171

>>14147156
The ending's impact is lessened due to a fourth film being made.

>> No.14147172

>Aside from that they are also weak to the food garlic. Just from smelling it, they become virtually drunk, and their thoughts become unreliable. If they happen to end up with some of it in their mouths, rationality goes out the window, and they go wild just like the basic type of succubi.

>Garlic
>Not the instant 'Rape me please' button for vampires
dohoho

>> No.14147175

>>14147167
Nah, true suffering is knowing that you will never read another book written by Terry Pratchett or see a new Calvin and Hobbes.
Waterson saw it coming.

>> No.14147176

My mom has been gone all day and I'm hungry, what Monster Girl can cook the best?

>> No.14147178

>>14147176
Kill yourself.

>> No.14147182

>>14147165
>>14147172
Is now time to bait the other side?

>> No.14147183

>>14147172
Not following you here.

>> No.14147189

>>14147178
How am I supposed to kill myself on an empty stomach? Think for once.

>> No.14147191

>>14147176
What are you doing on 4chan if you can't drive?

>> No.14147192

>>14147148
Roulette says your date is a holstaur. Sushi would be a decent choice. It'll seem fancy and exotic. She'll be very impressed. She probably hasn't played much in the way of video games, but she'll probably be happy to learn. She might even give you a small bottle of milk as a thank you for the date.

>> No.14147197

>>14147183
Perhaps I misunderstood. Was it not implied that you could dom a vampire with the use of garlic? Because if that's the case, I have a hint for you. It's not the vampire asking to be raped when you give it garlic.

>> No.14147202

>>14147191
>Drive
>Getting a 4 wheeled 'please eat my money' machine.

>> No.14147203

>>14147191
Because I have nothing else to do. I'm a NEET with no driver's license or cooking abilities. There has to be some Monster Girl into NEETs right? I'm a clean NEET.

>> No.14147204

I want to sing cheesy 80s songs to a monster girl with 2 first names

>> No.14147212

>>14147203
Nigga, if you're going to be a NEET, you need to at least be prepared to spend the rest of your life learning to cook for yourself.

>> No.14147214

>>14147176
Shoggoth, just don't mind if her food tastes a little funny, she's only experimenting with new ingredients!

>> No.14147216

>>14147202
>getting a 4 wheeled ecobox to drift down the mountains in with your MG waifu
>eurobeat blasting, tire squealing, tofu delivery machine

>> No.14147219

>>14147203
>NEET
>Doesn't know how to cook
You fail as a NEET. Hand in your license

>> No.14147223

>>14147216
>Not just getting a shoggoth waifu
>Not having a 4 wheeled waifu 'please eat my semen' machine.

>> No.14147226

>>14147197
Oh, then you're entitled to your wrong point of view and this was warranted

>>14147172
>being this salty

I have one more item for you. Raging Mushrooms.

>b-but those only work if the MG wants sex!
Uh huh...
>well what if you run into a married MG?
And she's be bothering with me because?
>well, It just goes to show that if she's married, a MG cannot be beaten
Yeah, enjoy your headcanon, or your trolling or whatever weenies enjoy these days.

>> No.14147227

>>14147161
>Vampire waifu makes garlic wine at home
>Smells terrible, tastes worse
>She chugs a huge glass of it
>"Uh, should you really be doing that? Is that even tolerable to drink? I can smell it from here."
>"S-shut up! I'm need'n this ta... I'm need'n... I'ma need what's that word? Courage! I'ma need courage'a tell ya this sho listen up! I-I wan' you ta m-m-make me a mommy."

>> No.14147228

Vampires are shit.

>> No.14147236

>>14147228
Nah, go fuck yourself, fam.
http://i.imgur.com/xecAEHE.png

>> No.14147239

>>14147236
>posting a retard with fangs

Sure helping your case there.

>> No.14147241

>>14147226
>projecting salt into what is a quote, a laugh and a meme arrow
Nice.

>All these other things I never said
Not even going to bother reading those. Also sutterposting doesn't help you.

>> No.14147242

>>14146712
Out into the town to see some new movie then maybe into a couple of stores until it's time to eat at a restaurant then back at my place to get to know each other maybe try to sketch her a picture before ending the date.

>> No.14147253

>>14147144
What? Can't I even mention my vampire waifu being a dom, which is not even something uncommon, without any of you faggots getting upset?

>> No.14147255

>>14147241
I'm just nipping in the bud the ten or twenty more shitposts you were obviously going to do.
Me have garlic and mushrooms. Pretty monster is gon git raped. You, make water with eyes and build stone house over it.

>> No.14147260

>>14147219
>tfw can't even be a NEET
Am I essentially nothing then?

>> No.14147261

>>14147253
>what I can't mention a hellhound sub without any of you faggots getting upset?

EQUALITY!

>> No.14147266

>>14146712
A romantic candlelit dinner, followed by a romantic movie.

I would then take her back home and put it in her butt.

>> No.14147267

>>14147192

Sounds like a good time. I'm pretty happy with that outcome.

>> No.14147269

>>14147260
Precisely. You have failed as a human bean
You will not be allowed through the gates of Valhalla

>> No.14147273

>>14146961
Just put it on a paper towel or something. No fuss, no mess.

>> No.14147276

>>14147269
But then...where am I going? I can't just disappear into the void or anything, r-right?

>> No.14147277

>>14147261
That's just one shitposter though, everyone else is fine that Hellhounds can't be subs.

Fuck off.

>> No.14147281

>>14147261
You can't even compare those two situations, since one follows what most people believe about one species and one doesn't.

>> No.14147285

>>14147276
That is exactly where you are going
Deep into the darkness of the void. You will be forgotten. Your legacy will fade into obscurity.
But there is a way to redeem yourself

>> No.14147287

>>14147115
>>14147121
>>14147128
>>14147167
Its also gonna be a supermoon. A superbloodmoon. Prepare your pelvises.

>> No.14147288

>>14147255
The garlic is detrimental tho. Why give it to her in the first place, when it only makes her harder to control? Why not just take the mushroom only? You're basically giving her her own bran of raging mushroom. Which puts you back at square one. Which gets you dom'd. You're not very smart are you?

>> No.14147290

>sexytimes with waifu
>when she invites you into the bedroom she's on the bed wearing that outfit you like
>there's music playing in the background to aid with the seduction
Based on what species she is, what music is it?

>> No.14147294

>>14147261
Vampires being doms follow the profile, so it shouldn't start any shit since everyone could assume that. Hellhounds being subs don't.

>> No.14147296

>>14147277
>hellhounds can't be subs

Nice headcanon.

>>14147281
>nuh uh, this is totally different
>when MGs are there to do whatever you want them too

yawn.

>> No.14147302

>>14147285
>But there is a way to redeem yourself
Nevermind, I give up. To be lower than a NEET is a gigantic crushing revelation, might as well accept it.

>> No.14147304

>>14147296

Yeah it's silly. How hard could it be for a hellhound to put together a sub sandwich?

>> No.14147307

>>14147288
Talking not building. Imagine that in a sing song tone.

>> No.14147310

>>14147296
Leave already you shitposting faggot.

Hellhounds can't be submissive, now go away.

>> No.14147311

>>14147277
This bait again?

Jesus...

>> No.14147312

>>14147302
Damn, I wanted to see your crushing reaction when I told you that there wasn't.
Alas, I digress. Begone

>> No.14147319

>>14147290
Gregorian moaning. Low, horny, sensual gregorian moaning.

>>14147296
>you can dom a hellhound
Your headcanon is quite fine aswell

>>14147307
Answer the question, dicklord. why give her the garlic in the first place?

>> No.14147321

I'm convinced >>14147310 and >>14146627 are the same dude.

>> No.14147322

>>14147311
He wasn't all to fond of the peace and quiet I'd assume.

>> No.14147323

>>14147290
I immediately thought of a wurm playing the wheels on the bus go round and round.

>> No.14147329

>>14147312
LET'S GO THERE TOGETHER

ALLAHU AKBAR

>> No.14147331

>>14147294
Oh now the profiles matter, no, KC totally isn't shit right?

You're out of your league sonny boy.

>>14147304
What?

>>14147310
>he doesn't like someone enjoying MGs a certain way
>s-s-shitpost!
>when everyone agrees the profiles are generalizations anyway
>except when someone is portraying them in a way I don't like

See my first reply.

>> No.14147332

Careful not to fall for >>14147310

>> No.14147333

>>14147290
>Mantis
Probably some barely audible ambient with a hue of nature.

>> No.14147334

>>14147322
Don't mind it.
Just remember to bolt your doors and board your windows tonight, friends.
http://i.imgur.com/UhnoDzk.png

>> No.14147339

if I'm even worse than a neet, i'll just go ahead and sell myself as a slave

why even bother you know

>> No.14147340

>>14147290
>shark girl
Probably something beachy and tropical. Like https://youtu.be/NDH1bGnNMjw

>> No.14147341

>>14147319
Nope. Because I don't have to explain shit to you and you'd just dismiss everything I'd say anyway.

>> No.14147343

>>14147322
How is this faggot not banned yet?
I got banned once for posting "No" for fucks sake.

>> No.14147345

>>14147331
>Oh now the profiles matter, no, KC totally isn't shit right?
Because of course you have magic and know what I've ever said about KC, right. Protip: there are more femdomfags ok with what KC normally says than any other type of -fag

>> No.14147348

>>14147343
Because people don't report, assuming he'll just tire himself out, when people just KEEP REPLYING.

>> No.14147351

>>14147340
>Shark girl
>Waiting in the room playing beachy music
>Not stalking you through the house naked while this plays: https://www.youtube.com/watch?v=o4RFX97cY4Y

>> No.14147353

>>14147345
Source: My ass

What you gonna pull a strawpoll now? Pls do, I want to laugh more.

>> No.14147356

>>14147351
Maybe she's in a seductive mood instead of a rapetrain (rapeboat?) mood.

>> No.14147358

What is it this time?

>> No.14147361

>>14147345
>>14147353
Listen, we don't really need to start a fight over something trivial like maledom/femdom, do we?
It's pretty dumb if you ask me.
Besides, everyone knows the real question is IS SHIROHEBI BEST GIRL, OR APOPHIS!?

>> No.14147362

>>14147353
Well maybe you should tell me how you do to know what everybody thinks about everything since that's what you're doing.

>> No.14147364

>>14147341
I am legitimately intrigued as to why you would give your vampire waifu her own brand of raging mushroom, just to take one yourself and end up cancelling the enhancing effects of the mushroom, with the enhancing effects of the garlic.

>> No.14147368

Still think >>14147310 and >>14146627 is the same guy.

>> No.14147372

>>14147368
Of course he is. This guy have been playing both sides for quite a while.

>> No.14147374

So here's this, all edited and story-ized. I didn't add much, but I made it more cohesive and tidied it up a lot.
http://pastebin.com/rS7k8uAJ

The buttslut trend will continue with Loli Shirohebi sometime next week.

>> No.14147376

>>14147361
Yes.

Now to merge a shirohebi and apophis.

>> No.14147381

>>14147372
And of course, he won't deny the fact that he is with a screencap or nothing, because he can't.
Ooh, bitches be makin' me mad today.

>> No.14147384

I'm still can't believe we're having another fight just because I mentioned that my waifu is a dom from a species normally described as doms.

What's next? Having a shitstorm because somebody mentioned an Ushi-Oni raping a guy?

>> No.14147386

>>14147374
>Loli Shirohebi
I'm sold anon, keep on keeping on

>> No.14147387

>>14147374
>The buttslut trend will continue with Loli Shirohebi sometime next week.
Fuckin' nice.

>> No.14147388

>>14147384
REEEEEEEEEEEEE!

>> No.14147390

>>14147374
Can't wait!

>> No.14147392

>>14147384
Nobody cares.
Really.
It's just the saltman fucking around again.

>> No.14147395

>>14146273
them's fightin' words.

>> No.14147404

>>14147384
Ushis don't rape, they're masochists into shibari.

>> No.14147407

>>14147386
>>14147387
>>14147390
Thanks anons, I'm pretty hype.

>> No.14147417

>>14147404
Sadomasochists into shibari.
>She will never tie the both of you up, with only her arm free to pull on a rope that makes you thrust into her spider pussy

>> No.14147420

>>14147384
We're having a fight because we can't have vampire subs apparently, when garlic, sunlight, raging mushrooms and them being proper wives to incubi are a thing.

>> No.14147424

>>14147417
She could totally still have both hands tied behind her back and still be able to pull anon.

>> No.14147426

>>14147417
>you will never try to swing to each other in some bizarre trapeze act

>> No.14147427

>>14147424
Like, with her teeth?

>> No.14147432

>>14147427
No anon, with her hand. Just a little bit of slack in the threads and she could still have that feel of being fully bound and helpless.

>> No.14147434

>>14147420
Neither garlic or their husbands being incubi make them subs.

>> No.14147438

>>14147427
Why, is she gagged? Forced to make her bound husband fuck her with a ball of web tied in her mouth that also controls his thrusting?

>> No.14147447

>>14147434
>but as far as they are concerned, copulation with a human being is a filthy act, so most vampires will probably try to control their lust.

>Aside from that they are also weak to the food garlic. Just from smelling it, they become virtually drunk, and their thoughts become unreliable. If they happen to end up with some of it in their mouths, rationality goes out the window, and they go wild just like the basic type of succubi.

They'll be begging for the dick.

>They are full of pride, considering themselves to be nobility while looking down upon humans as lesser beings.

>Men whom they are fond of are taken away to their homes and kept as both servants and food sources, being forced to take care of the vampire herself.

>Men who have become incubi are regarded as nobility, the same as themselves, and thus they become treated as husbands.

If you imagine yourself being under her heel even after incubization that's your thing, but the fact of the matter is servant treatment ends with incubization and they act like proper wives. Sub vampires are a go.

>> No.14147448

>>14147438
She wouldn't be gagged.
She'd just be pulling on the fuck rope with her teeth.

>> No.14147449

>>14147447
Just stop.

>> No.14147456

>>14147448
Lame.

>> No.14147457

>>14147449
I'm not doing anything wrong.

>> No.14147458

>>14147457
Yes you are.

>> No.14147462

>>14147447
You're interpreting things on your own way. Nothing there says they become a sub.

It's like talking to a brick wall.

>> No.14147464

>>14147456
Perhaps I missed the mark there.

>> No.14147465

>>14147458
You sound like my autistic cousin when he tries to come up with a legitimate response.

>> No.14147468

>>14147458
Says you. It sticks in your craw when someone talks about a "dom" monstergirl as a sub. It doesn't bother me when people talk about dom kikis or kobolds, I just ask for the same courtesy when the opposite comes up, but apparently that is not to happen. Well tough shit, because I'm gonna and no one can stop me. Bother who it bother.

>> No.14147469

>>14147462
>Trying to argue with a nigga who's made it his mission to "strike back" at the "maledomfags"
There's not much to expect in that regard.

>> No.14147470

>>14147462
>you're interpreting things your own way

SUCCESS! THIS ONE FINALLY GETS IT! MGE IS MADE SO YOU CAN HAVE ANY GIRL YOU WANT, HOW YOU WANT! GO FORTH MY CHILD AND BRING THE LIGHT OF UNDERTANDING TO THOSE IN THE BONDAGE OF IGNORANCE!

>> No.14147471

>>14147468
Please get banned already.

>> No.14147476

>>14147469
Are you sure you quoted the right person?

>> No.14147477

>>14147468
>It doesn't bother me when people talk about dom kikis or kobolds
>Earlier was like >>14146419, >>14146536
>I'm not mad, guys

>> No.14147484

>>14147471
I'm not the saltman I'm afraid, just someone who's had enough of the thread's shit.

>>14147468
>>14147310
>>14146627
>>14146651
>>14146666

>> No.14147487

>>14146419
>>14146536
>>14147477
I know it's been a long day anon, but boogeymanning doesn't become you.

>> No.14147488

>>14147484
I'm pretty sure that's all one guy.
Scratch that, I'm pretty sure all that is you.

>> No.14147489

>>14147484
You ARE the thread's shit.

>> No.14147490

>>14147447
>they go wild
>They'll be begging for the dick
Anon are you sure that's how it goes?

>> No.14147493

>>14147488
Believe what you want.

http://imgur.com/CjtmqJp

>> No.14147495

>>14147484
How the fuck have you not been banned yet?

All you've done today is start fights, god damn.

>> No.14147499

>>14147490
And drunk, and their thoughts become unreliable, easy to take advantage of someone not in their right mind. They aren't on crack. They're on ghb.

>> No.14147502

>>14147490
In fact, I'm pretty sure it's the other way around.
>When enveloped in the smell of garlic, she runs towards you, planting her face in your crotch unzipping your pants with her teeth.
>She then tackles you and rides you ragged like a basic succubus would
Jesus, imagine.
>When Wario eats garlic, he becomes Wario-Man.
>When a vampire eats garlic, she becomes _____Anna.___

>> No.14147506

>>14147495
Because I'm not the guy from earlier, no matter how much you say I am. See >>14147493

>> No.14147508

>>14147502
GARLIC CONFIRMED OP, PLEASE NERF

>> No.14147512

>>14147502
Who's Anna? Can someone spoonfeed my plebic ass?

>> No.14147513

>>14147506
Like I'm going to believe your MS Paint skills.

>> No.14147516

>>14147499
Sorry but it sounds more like they go berserker and rape people, not that they go sub just because that's what you prefer to think.

Or I guess that suddenly "wild" and "drunk" are not a synonym for aggressiveness anymore.

>> No.14147517

>>14147512
http://statici.behindthevoiceactors.com/behindthevoiceactors/_img/chars/char_148545.jpg
Have you heard about the anime where the girl bakes cookies with her pussy juice?
That's her.

>> No.14147518

>>14147512
Shitty character from an even shittier anime where the second worst possible girl wins.

>> No.14147520

>>14147493
I have to come clean, I am the spirit of salt, I died while shitposting in the toilet and I'm possesing you all

http://i.imgur.com/YEqX1tA.png

>> No.14147525

>>14147517
Oh fuck, I'm retarded.

I thought that anon was referring to a vampire named Anna.

>> No.14147526

>>14147513
I knew you'd say that. Bu the proof is in the pudding, I'm still here, so go ahead and report me if you like. I'm not sweating. Shall I point out all the posts I've made in the thread to make It easier for you?

>>14147516
I could say the same to you. This is the "kikimoras are totally fucking doms who take over your life if you're lazy!" BS. Excuse me while I give zero fucks what you think.

>> No.14147533

>>14147520
>http://i.imgur.com/YEqX1tA.png
Okay, I laughed.

>> No.14147534

Please discuss awawawa snow monsters warmly
http://i.imgur.com/I140a1K.png

>> No.14147538

>>14147526
>Excuse me while I give zero fucks what you think
Likewise. At least I don't try to push my own headcanon as canon like you are doing.

>> No.14147539

I want a wendigo to bash my fookin' 'ead in!

>> No.14147541

>>14147534
WAIT, ANON!
http://i.imgur.com/T63I3oO.jpg

>> No.14147543

>>14147534
>Wanting to be a monster boy

>> No.14147544

Beautiful full moon we got over here, eh, west-coast anons? Stay sa

>> No.14147548

>>14147541
What happens if I move?

>> No.14147550

>>14147534
Congratulations /mgt/, this is one threadcanon piece that isn't shit.

That makes the total amount of two threadcanons that aren't shit.

>> No.14147552

>>14147538
>headcanon
>implying that's not you with "NO! X MONSTERGIRL CAN'T BE SUB!"

You're adorable and wrong. Every MG is Dom. Every MG is sub. Deal with it.

>> No.14147554

>>14147548
warm hugs and a fur coat

>> No.14147555

>>14147548
DON'T MOVE!!
Its vision is based on movement, anon.

>> No.14147561

>>14147534
So would turning into her coat be a better thing to do or no?

>> No.14147562

>>14147543
Becoming one with the cloak is entirely optional.
Anyways, I liken the whole cloak thing to how Canti "uses" Naota in FLCL, except you can pop out whenever you want to stretch and stuff.

>> No.14147563

>>14147555
But what happens if I move?

>> No.14147564

>>14147550
What's the other one?

>> No.14147566

>>14147552
>implying that's what I said
>When you mentioned 4 ways to make vampires sub and I only mentioned that 2 of them were wrong.
Keep trying, retard.

>> No.14147569

>>14147563
God save your pelvis, anon.
It'll be pretty bad.

>> No.14147570

>>14147561
You can leave shadow monster form whenever you want, or you can stay in shadow form and pleasure her

>> No.14147572

>>14147564
/hbg/

>> No.14147575

>>14147566
Contain your salt, you're scaring the slugs.

>> No.14147582

>>14147572
Ha, no.

>> No.14147583

>>14147572
All the shitposting over sub baras and dom shotas.

>> No.14147585

>>14147575
Salt? I'm not the one that have been using an aggressive tone on this discussion.

Nothing else to say?

>> No.14147590

>>14147585
>aggressive tone
Not my fault you're a delicate rose.
>Nothing else to say?
Sub hellhounds best hellhounds.

>> No.14147595

>>14147569
Pfft, they're not even up to my kneecap.
Like they could do anything.

>> No.14147597

>>14147447
>They'll be taking the dick.
FTFY. no Vamp will beg a lower life form for the dick. She takes as she pleases.

>> No.14147602

>>14147597
Lies and salt.

>> No.14147605

>>14147590
>>14147585
Switch everything best everything.

>> No.14147606

>>14147590
Yes, I guess we can consider this discussion settled since you don't even try to stick to the point anymore.

>> No.14147610

>>14147548
You swap places with her.

>> No.14147611

>>14147605
Vanilla best everything.

>> No.14147617

>>14147602
Can't fight the V anon. It;s every man's destiny to lose.

>> No.14147618

>>14147611
Indeed.
Handholding best fetish tbh

>> No.14147619

>>14147606
>implying there ever was a point
>implying you're not just being another opinionated fag mouthing off because someone said something you didn't like

You get more precious by the second.

>> No.14147624

>>14147617
>He'll get tired eventually.jpg

>> No.14147625

>>14147610
>I get to be a nervous fluffy coat loli who stalks people in the snow
this is my life now and I accept it

>> No.14147629

>>14147618
I want to hold hands with a fluffy paw girl and use them as mittens in the winter

>> No.14147632

>>14147548
AWAWAWAWWAWAWAWAWAWAWAWAWWAWAWAWAWAWAWWAWAWA

>> No.14147636

>Monster girls
http://i.imgur.com/VGaFj4t.jpg

>> No.14147637

>>14147618
>>14147611
That's an odd way of writing gangbangs and corruption.

>> No.14147643

>>14147619
>says the person who have been trying to defend his headcanon desperately
You also get funnier by the second. You may have shit taste but at least are entertaining.

>> No.14147644

>>14147624
What, you thought the D was the only infallible force? If the D is a spear that always pierces, then the V is a net that will always snare the spear.

>> No.14147645

Just let the argument die and discuss Wendigos.

>> No.14147650

>>14147645
when I'm her monster, will I be able to pick her up with one hand and use her like an onahole?

>> No.14147651

>>14147643
Whatever you say kid.

>> No.14147652

>>14147636
>certain child abuse sites have been removed from results
Did I just get myself on a watchlist

>> No.14147654

>>14147644
But what happens when a juggernaut thrusts into an unbreakable wall?

>> No.14147663

>>14147654
What's the unbreakable wall an analogy for?

>> No.14147665

>>14147650
I thought that's how it worked? You become a giant monster to protect her, she becomes an onahole for you monster dick.

>> No.14147668

I want to dom a hellhound

>> No.14147669

>>14147645
For being another satyr-hooved, beast-horned loli species, they sure make themselves better than Baphomets somehow.
Maybe it's simply because they're nicer girls on the whole?

>>14147663
Inner walls.

>> No.14147670

>>14147632
I'm not following you, explain what happens when she makes that sound.

>> No.14147672

>>14147668
I guess we all have pipe dreams huh

>> No.14147677

>>14147668
So do I. Would you make her wear frilly dresses and take her for walks? Would you let her sleep on the bed or keep her on the floor, lest she think she's people?

>> No.14147678

>>14147652
http://exhentai.org/g/746605/d0558c9cf7/

>> No.14147684

>>14147672
I said dom, not dehumanize. Get out of here with your shit.

>> No.14147685

>>14147668
I want to call to Animal Control

>> No.14147686

>>14147670
She blushes, runs around nervously and makes the "awawawawawa" sound

>> No.14147687

>>14147668
And you can, let no bitchboy tell you otherwise.

>> No.14147689

>>14147686
Then why would I not move?

>> No.14147692

>>14147684
Was meant for>>14147677
My bad

>> No.14147695

>>14147678
Thankye. Hopefully this will soften the sting of being v&.

>> No.14147696

>>14147668
I want her big enough to ride, but sweet and submissive. Imagine seeing a guy belly rubbing a 9 foot tall dog.

>> No.14147697

>>14147668
Not allowed.

>> No.14147698

>>14147689
She's blind and she uses sound to find you, sit still and she goes into awawa mode

>> No.14147702

>>14147669
>Inner walls.
But those are very breakable. You're bad at analogies.

>> No.14147703

>>14147687
It still feels weird that lamia take dicks near the end of the tail instead of where the pelvis would be on a human.

>> No.14147704

>>14147668
Good taste, friend.

>> No.14147708

Can we change the subject already.

>> No.14147712

>>14147692
So what would you do, oh paragon of ethical treatment of mosntergirls?

>> No.14147714

>>14147698
And then you quickly step directly into her path, so that instead of following your trail at a distance and finding your tired body like she thought she would, she bumps face-first into your crotch.

>> No.14147718

>>14147668
Mein Hundmeister.

>> No.14147721

>>14147708
Nekomata clawing and kneading your chest as they ride you.

>> No.14147722

>>14147697
It is now.

>> No.14147723

>>14147668
I totally believe all the replies are different people.

>> No.14147724

>>14147669
We need a white haired Baphomet in a fur cloak for comparison.

>> No.14147726

>>14147698
>>14147632
>>14147689
http://vocaroo.com/i/s0psCCqG2CEk

>> No.14147729

>tfw whipping your hellhound to make her feel at ease

>> No.14147731

>>14147697
>>14147722
If it is done right read: believably.

>> No.14147734

>a 7 foot tall, muscular Werewolf with big titties will never force herself on you in a fashion similar to kabe-don
>you will never lock up in fear and start crying
>you will never activate the Werewolfs protective instincts
>she will never sit you on her lap and cover you with her jacket as you calm begin to calm down

>> No.14147735

I want to be dommed by a kobold! I want her to put a collar on me and take me for walks.

>> No.14147736

>>14147731
>If it is done right

So never? Got it.

>> No.14147737

>>14147726
ok then?

>> No.14147739

>>14147731
>right
>belieably
So never

>> No.14147742

>>14147735
Not allowed.

>> No.14147743

>>14147731
>only if done how I like it

Nah, fuck every single one of you "if these conditions are met" guys. It's just like when a man beating a MG comes up, if it's too easy he's a gary stu, if he doesn't get the stuffing beaten out of him beforehand it's shit, if he does wing easy it has to be a fluke. Seriously, to sub hellhound hell with you all.

>> No.14147747

>>14147742
No anon, that's allowed.

It's the other thing that's not allowed.

>> No.14147749

>>14147735
Well that sounds fucking stupid, but you do you.

>> No.14147750

>>14147747
Says you

>> No.14147752

>>14147731
I can think of someone who might be able to do it.

>> No.14147754

>>14147747
But that's wrong.

>> No.14147756

>>14147734
Will she protect me and heal me from all of the emotional and psychological abuse I've had since growing up?

>> No.14147762

>>14147747
Both are.

>> No.14147764

>>14147747
last time I checked anal was okay

>> No.14147765

>>14147736
That is to say, believably.
Like, the guys who were talking about shibari earlier.
That would make sense as far as an Ushi-Oni is involved following the kind of logic >>14146853 goes by.
>Absurdly strong spider
>Likes to play it safe to keep from hurting people
>Likes to engage in shibari play for this very reason, being a spider that likes to limither own strength
>Still aggressive as fuck, but likes having fun with her man in a way that keeps him safe

Something like that that would make sense to a hellhound would totally be likeable and I'd totally be down for it.
That one story where they were all sometimes pets and sometimes not, though, that didn't make much sense.

>> No.14147769

>>14147756
You're gonna get embraced by those big meaty paws and spill your heart out to her.

>> No.14147773

>>14147583
Nah, fuck every single one of you "if these conditions are met" gals. It's just like when a monmusu beating a HB comes up, if it's too easy she's a mary sue, if she doesn't get the stuffing beaten out of her beforehand it's shit, if she does wing easy it has to be a fluke. Seriously, to sub bara hell with you all.

>> No.14147777

>>14147726
Gotta be higher pitched and more scared

>> No.14147778

>>14147731
>>14147739
>>14147765
>believably
>magic monsters from happy end-land
Pick one.

>> No.14147779

>>14147765
Except that there's no need for that since the profile already says that they don't mind the man being in charge for a while in sex.

The point is that people here want to make them kobolds.

>> No.14147780

>>14147765
So never.

I already got it the first time.

>> No.14147781

>>14147734
>You will never slap her shit against all odds

Wolves are not for submitting to. They're for beating and building harems with.

>> No.14147786

>>14147779
Oh yeah. There is that.
So what's everybody arguing about, then?

>> No.14147790

>>14147765
>so only if she permits it

Sorry pok gai, your shit is done.

>>14147779
It shall be so.

>> No.14147792

>>14147781
They weren't even engaging in combat in the first place?

>> No.14147795

>>14147781
I totally believe you could beat a pack of werewolves on a modern setting without magic.

>> No.14147797

>>14147790
I dunno.
I find the idea pretty hot either way, don't you?

>> No.14147798

>>14147792
Live in a nice, controlled access neighborhood?

>> No.14147804

>>14147798
Why the hell are you twisting a simple greentext into the cancerous dom/sub shit going on right now?

>> No.14147805

>>14147795
Yeah you could, now fuck off.

>> No.14147806

>>14147786
>So what's everybody arguing about, then?
Hellhounds. What else?

>> No.14147808

>>14147805
Sure anon. Sure.

>> No.14147809

>>14147795
Of course you can with silver-painted rubber bullets.

>> No.14147811

>>14147769
Well then I hope she enjoys me telling her my life story and professing all my insecurities to her, all while clinging to her side and becoming attached to her, and absently calling her Onee-chan.

>> No.14147812

>>14147795
>the pack
>not the leader in single combat

Yeah, that's totally what I said.

>>14147797
>dominating
>LETTING you dominate

False dom.

>> No.14147813

>>14147804
Son, this is what we in the business call "bait".

>> No.14147817

I want to break into a kitsune's house and eat all of her fried tofu!

>> No.14147819

>>14147817
Tofu is bad.

>> No.14147820

>>14147781
>Wolves are not for submitting to.
hahahahah

>> No.14147821

>>14147812
You didn't mention any leader, anon.

>> No.14147822

>>14147798
What does living in gated communities have to do with a Dire Werewolf and a human falling in love together?

>> No.14147825

>>14147809
That's not a bad idea actually.

Why not just use silver knuckles though? Or wolvesbane?

>>14147808
Fucking lv1 scrubs.

>> No.14147830

>>14147795
Can I challenge the pack leader to a friendly game of lamias and ladders?

>> No.14147836

Despite all the shitflinging about who's on top, I personally find the best part about Hellhounds to be their protective attitude towards their husband.
Despite all the stuff they may or may not do to you, it's heartwarming to know they'd protect you and do it while saying, "Nobody hurts my husband ever."

It's cute, you know?

>> No.14147838

>>14147820
What a clever and witty post. I'm sure your mistress is gonna peg you extra hard for that one.

>> No.14147839

>>14147821
If you read the profile, and I'm mentioning them being sub, you should be able to put two and two together.

>>14147820
Yes, submitting and missing out on getting your dick wet at your leisure is laughable.

>> No.14147840

>>14147811
Hnnngh.

>> No.14147841

>>14147817
>she catches you eating the last of her tofu and decides to fetch it back
>your last conscious moments that evening are suffocating on a foot of fox tongue down your throat

>> No.14147843

>>14147817
Don't do it anon! She will catch you and make you work to repalce it! As you help her around the house you two will become closer and closer and one evening you will look at each other's eyes realize they are the one!
Trust me, I have a wife and two daughters because of this!

>> No.14147845

>>14147811
Disgusting.

>> No.14147846

>>14147841
Minus the whole dying thing I think that's really hot.

>> No.14147851

>>14147734
>Kabe-don
This is why you always carry a mechanic's creeper with you.
You just plop it down on the floor, lie back-down on it, and just roll right under her.
And then get the fuck out.
Always. Bring one with you.

>> No.14147852

>>14147822
>someone is menacing you
>not in combat

Only someone who's never been in a fight or really sheltered would think this.

>>
Name
E-mail
Subject
Comment
Action