/smg/ Shizcho Proganda General Market.

File: 2.01 MB, 640x640, 1677530520629380.webm [View same] [iqdb] [saucenao] [google]

/smg/ Shizcho Proganda General Market. Anonymous Mon Mar 6 21:09:30 2023 No.53957857 [Reply] [Original]

You can't hear it. You can't feel it, but you get heemed by it. You trades lose because of it. You know it's there. Always with you fucking up your gains.

There HERE!!!!!!!!!

Shizcoucational sites:
https://www.investopedia.com/
https://www.khanacademy.org/economics-finance-domain

>Shizcoancial TV Streams:
https://watchnewslive.tv/watch-cnbc-live-stream-free-24-7/
http://www.livenewson.com/american/bloomberg-television-business.html
https://watchnewslive.tv/watch-fox-business-network-fbn-free-24-7/

>Shizcoyarts:
https://www.tradingview.com
https://www.finscreener.com
https://www.koyfin.com/
https://www.portfoliovisualizer.com

>Shizcoeeners:
https://finviz.com/
https://www.tradingview.com/screener
https://etfdb.com/

>Shizcotions
https://www.optionsplaybook.com/options-introduction/
https://www.optionsprofitcalculator.com
https://optionstrat.com/
https://www.optionistics.com/quotes/option-prices

>Shizco-Market and Live data:
https://www.investing.com/indices/indices-futures
https://finance.yahoo.com/

>Shizcoendars
https://www.marketwatch.com/economy-politics/calendar
https://www.earningswhispers.com/calendar
https://www.cmegroup.com/trading/interest-rates/countdown-to-fomc.html

>Shizcomer Investing 101:
https://www.bogleheads.org/wiki/Getting_started

>Misc:
https://tradingeconomics.com/
https://finance.yahoo.com/trending-tickers
https://market24hclock.com/
https://wallmine.com/
https://fintel.io/
https://www.dividendchannel.com/drip-returns-calculator
https://brokerchooser.com/
https://www.chathamfinancial.com/technology/us-market-rates

Previous >>53956962

>>	Anonymous Mon Mar 6 21:10:10 2023 No.53957869 this land is cursed

>>	Anonymous Mon Mar 6 21:10:47 2023 No.53957877 Please keep your mental illness to a minimum in this thread, thank you.

>>	Anonymous Mon Mar 6 21:10:55 2023 No.53957882 File: 220 KB, 1587x904, 13259539189000.jpg [View same] [iqdb] [saucenao] [google] >>53957857 >Shizcho

>>	Anonymous Mon Mar 6 21:10:58 2023 No.53957883 I'm embarrassed to even report how my portfolio performed today.

>>	Anonymous Mon Mar 6 21:11:35 2023 No.53957889 How do I become a onions boy?

>>	Anonymous Mon Mar 6 21:12:04 2023 No.53957895 >>53957883 If you can't face your losses, your wins won't be as sweet. Also that's a very easy way to end up bagholding.

>>	Anonymous Mon Mar 6 21:12:04 2023 No.53957894 File: 2.99 MB, 720x404, 1674084311681591.gif [View same] [iqdb] [saucenao] [google] fucking hate this market.

>>	Anonymous Mon Mar 6 21:12:11 2023 No.53957898 File: 2.46 MB, 1469x1054, golden_brown.png [View same] [iqdb] [saucenao] [google] Nobody knows which poster from the previous thread I am

>>	Anonymous Mon Mar 6 21:12:44 2023 No.53957906 File: 25 KB, 703x360, 1638828268486.jpg [View same] [iqdb] [saucenao] [google] >>53957898 I know you're the schizo racist Indian.

>>	Anonymous Mon Mar 6 21:13:08 2023 No.53957911 File: 55 KB, 552x769, 1678134932630552.jpg [View same] [iqdb] [saucenao] [google] >>53957882 It's the korean version of Schizo

Anonymous Mon Mar 6 21:13:35 2023 No.53957919
File: 184 KB, 2850x328, Screenshot 2023-03-06 at 1.13.11 PM.png [View same] [iqdb] [saucenao] [google]

>>53957670
My white school shooter friend, if you want to know why Indian-Americans are far more successful / wealthy than Whites in the USA, its because we're smart enough to short shitty uranium miners like DNN. Pic related lol. Wondering what kind of uranium bags you're holding to make you seethe this much about the fact that my capital gains taxes on shorting uranium names are going to pay for your cousin's opiate overdose in Kentucky

>>	Anonymous Mon Mar 6 21:14:10 2023 No.53957925 >>53957889 listen if you become a soiboi you might have ONE average brown girl mildly interested in you, but if YOU become the bpd art-type one then you will have DOZENS of average brown girls VERY interested in you

>>	Anonymous Mon Mar 6 21:14:21 2023 No.53957927 File: 736 KB, 758x658, Go on a diet, ya fat bitch.png [View same] [iqdb] [saucenao] [google] >Entire threads covering fast food only indicates America's growing obesity problem All the more reason to be long on KO, MCD, and YUM

>>	Anonymous Mon Mar 6 21:15:05 2023 No.53957940 >>53957927 Don't forget to long GO.Grocery Outlet sells super cheap dogshit that EBT goy cattle eat. Great deals at GO though.

>>	Anonymous Mon Mar 6 21:15:05 2023 No.53957939 File: 253 KB, 220x220, 1677985652459486.gif [View same] [iqdb] [saucenao] [google] >>53957906 I haven't been offended this badly in a long time

>>	Anonymous Mon Mar 6 21:15:06 2023 No.53957941 >having even the foggiest fucking clue how anything works beyond what CNBC is spoonfeeding to redditors' assholes is "schizo propaganda"

>>	Anonymous Mon Mar 6 21:15:54 2023 No.53957951 >>53957889 Watch sissy hypno and drink Onions for every meal, also become a femminist.

>>	Anonymous Mon Mar 6 21:16:02 2023 No.53957953 File: 68 KB, 720x540, 1675276765557923.jpg [View same] [iqdb] [saucenao] [google] Good threads today guys

>>	Anonymous Mon Mar 6 21:16:17 2023 No.53957956 >>53957941 cool it down on the extremism anon, how dare you state that modern society is flawed and discouraging

>>	Anonymous Mon Mar 6 21:17:02 2023 No.53957967 A CHINESE CIA JOE BIDEN MARKET SETPOINT JUST MOLESTED MY PENIS OVER MY HOUSE

>>	Anonymous Mon Mar 6 21:17:11 2023 No.53957969 >>53957953 /biz/ is dead - always has been

>>	Anonymous Mon Mar 6 21:17:33 2023 No.53957973 Hey, the market did not dip much today, but it also did not go up much today. Do not go to the stock market tomorrow

>>	Anonymous Mon Mar 6 21:18:20 2023 No.53957985 >>53957967 WHAT DO YOU MEAN BY THIS ANON? WHAT IS A MARKET SETPOINT? DO YOU MEAN HOW IN CHINA ALL THE GLOWIES GET TOGETHER AND DECIDE WHAT THE PRICE OF VARIOUS STOCKS SHOULD BE? PLEASE EXPLAIN!

>>	Anonymous Mon Mar 6 21:18:31 2023 No.53957988 File: 168 KB, 1008x1038, Hello.jpg [View same] [iqdb] [saucenao] [google] This is a good investment, financially speaking. Also - I hate being right, but too early. How to cope?

>>	Anonymous Mon Mar 6 21:18:40 2023 No.53957989 >>53957927 MCD has just kept going up and up despite the death of the value menu being actual good deals and all their regular prices mooning to what used to get you actual good meals from actual real restaurants.

>>	Anonymous Mon Mar 6 21:18:49 2023 No.53957993 File: 39 KB, 656x679, b0e.jpg [View same] [iqdb] [saucenao] [google] I lost a small amount of money today

>>	Anonymous Mon Mar 6 21:19:37 2023 No.53957997 >>53957857 >blackmanfightssystemicracism.webm

>>	Anonymous Mon Mar 6 21:19:49 2023 No.53958002 >>53957988 get the air, the pro is a meme these days

Anonymous Mon Mar 6 21:20:15 2023 No.53958006

Good time to buy Intel now. They completed specifications on their new nodes and are releasing in 2024 ahead of schedule. And I think all the bad news is out of the way so it's only going to go up from here.

https://www.tomshardware.com/news/intel-completes-development-of-18a-20a-nodes

>>	Anonymous Mon Mar 6 21:20:30 2023 No.53958010 >>53958006 Massive short signal for INTC here

>>	Anonymous Mon Mar 6 21:20:47 2023 No.53958016 >>53957898 you're the anon that wants rocker's life ruined and was too much of a pussy to short NSC

Anonymous Mon Mar 6 21:21:53 2023 No.53958022
File: 359 KB, 1024x1024, 1674135338631667.jpg [View same] [iqdb] [saucenao] [google]

>>53957967
That reminds me, I saw a guy in a Beijing Biden t-shirt at the hardware store over the weekend. He looked like a textbook chud meme. I bet the non-binary, painted fingernail having genderfluid cashier was internally seething during the entire transaction.

>>	Anonymous Mon Mar 6 21:22:10 2023 No.53958025 File: 138 KB, 553x466, 1610467762227.png [View same] [iqdb] [saucenao] [google] I gained a small amount of money today

>>	Anonymous Mon Mar 6 21:22:51 2023 No.53958030 >>53957919 We heard you the first time.

Anonymous Mon Mar 6 21:23:15 2023 No.53958032
File: 1.79 MB, 197x213, 1669836086382095.gif [View same] [iqdb] [saucenao] [google]

What the fuck have you guys been posting about? Chicken wings? Chicken feet? Chicken penis? $2 pizzas? Haven't you forgotten that I'm speaking soon? Not a single person posted any meme with me and I feel offended. I will teach you the pain.
Powell out

>>	Anonymous Mon Mar 6 21:23:15 2023 No.53958033 >>53958025 Congrats nigger bear

>>	Anonymous Mon Mar 6 21:23:30 2023 No.53958038 >>53958032 WHOAH BLACK BETTY

>>	Anonymous Mon Mar 6 21:24:14 2023 No.53958045 >>53958032 you make less than a mcdonald's manager nigga, shut the fuck up

>>	Anonymous Mon Mar 6 21:24:23 2023 No.53958048 >>53958002 Hm yes, that is true - even though they scam you for the RAM cost, it still works out half the price for the M2 version. >>53958025 By doing what?

>>	Anonymous Mon Mar 6 21:24:27 2023 No.53958051 I will never recover from my $52 TQQQ average

>>	Anonymous Mon Mar 6 21:24:32 2023 No.53958052 >>53958025 >>53957993 boring equities market. KOLD KANGS EATING GOOD TONIGHT!

>>	Anonymous Mon Mar 6 21:24:35 2023 No.53958053 >>53958032 That was 2 threads ago

>>	Anonymous Mon Mar 6 21:24:44 2023 No.53958056 >>53957857 so is xtrx adastara going to be selling cocaine to distributors in canada or not!? I want to get in while it's under a dollar but if they aren't going to distribute cocaine they aren't going to have any liquidity and float! I'M CONFLICTED!

>>	Anonymous Mon Mar 6 21:26:23 2023 No.53958080 >waaaahhh there are black people >better waste my life trying to make enough money so me and mrs roastie can have an IVF baby at 45

>>	Anonymous Mon Mar 6 21:26:49 2023 No.53958085 File: 420 KB, 600x830, 120.png [View same] [iqdb] [saucenao] [google] Rocker-sama... TRKA shill-kun... I kneel.

>>	Anonymous Mon Mar 6 21:27:00 2023 No.53958086 >>53958080 AI post or schizo post?

Anonymous Mon Mar 6 21:27:28 2023 No.53958091

>>53957919
Who knew running immigration mills masquerading as shitty disgusting nigger magnet corner stores could be so profitable. Your counterparty risk is a whole country full of Indians not being shitty enough to want to flee at all costs so I guess it's a pretty safe investment;^}

>>	Anonymous Mon Mar 6 21:28:42 2023 No.53958106 >>53958086 Maybe it's both.

>>	Anonymous Mon Mar 6 21:28:50 2023 No.53958107 >>53958053 Previous thread is hard to describe. I think it could be used as a training myterial for detecting early onset of schizophrenia in demented patients.

>>	Anonymous Mon Mar 6 21:29:26 2023 No.53958112 >>53957919 yeah but whats the point of being rich when no women are attracted to you

>>	Anonymous Mon Mar 6 21:29:28 2023 No.53958113 >>53958086 >>53958106 >implying there's something organic about intelligence in the first place

>>	Anonymous Mon Mar 6 21:29:45 2023 No.53958118 >>53958080 45 year old man don’t need no IVF. Just a 25 year old wife.

Anonymous Mon Mar 6 21:30:23 2023 No.53958122

>>53958006

If they're still staffed by 90% jeets then lolno. The east asian competition will continue crushing them via 20 IQ point spread. Get back to me when Chyna really goes for Taiwan for realsies.

>>53958032

Personally I was posting about soup dumplings. It is entirely too hard to find the damn things in the US, and I would all-in on any startup that was gearing up to sell them fast-food style. I'm convinced they'd take off, if only people knew how delicious they are.

https://www.youtube.com/watch?v=5962719UC0s

>>	Anonymous Mon Mar 6 21:30:30 2023 No.53958123 >>53958118 well of course i agree with you, but >current year

>>	Anonymous Mon Mar 6 21:31:04 2023 No.53958129 >>53958107 Idk I thought it was nice

>>	Anonymous Mon Mar 6 21:31:43 2023 No.53958136 >>53958122 When is burgerland going to poach the bugmen from Taiwan to get their own semi conductor operations going?

>>	Anonymous Mon Mar 6 21:32:00 2023 No.53958140 >>53958112 That’s why God made created Bosnia. Pack your bags and go get a wife.

>>	Anonymous Mon Mar 6 21:32:28 2023 No.53958149 >>53957857 Shill me on why I'm retarded.... Long MRK Short EBAY WU HAS LULU UEC

>>	Anonymous Mon Mar 6 21:32:48 2023 No.53958152 Thread Theme: https://www.youtube.com/watch?v=Dkk9gvTmCXY

>>	Anonymous Mon Mar 6 21:32:52 2023 No.53958155 >>53958051 Come back in 10 years

>>	Anonymous Mon Mar 6 21:32:59 2023 No.53958156 >>53958136 could the nips be persuaded to take them in? japan needs to be a tech powerhouse again

Anonymous Mon Mar 6 21:33:11 2023 No.53958159

>>53958051
Yikes bro. Just dca! I trade a lot of that shit too. Just put a stop in 10% under the price and bump it up every day. I was sad when my sqqq tapped the stop at 38 and shot up to 41, but now I'm glad it happened. Bump till stop gets tapped then reverse, only way to do 3x

Anonymous Mon Mar 6 21:33:53 2023 No.53958166

>>53958129
I liked it too. Reminded me of shittalk from 2021 bullrun era. The magical part is almost nothing was said despite us producing 300 posts. It's like magic.

>>53958122
Can't help you with that mate. You can always buy some t-bills if you want to support my startup tho.

>>	Anonymous Mon Mar 6 21:34:00 2023 No.53958168 >>53958152 untalented giraffe looking bitch the fucking TJ Maxx of music

>>	Anonymous Mon Mar 6 21:34:23 2023 No.53958174 >>53958136 you mean we need to start colonies of bugs in Arizona, Texas, Ohio? Is that why Ohio got gassed?

>>	Anonymous Mon Mar 6 21:34:53 2023 No.53958178 File: 2.03 MB, 1047x1360, 1678009251261845.png [View same] [iqdb] [saucenao] [google] >>53957894 Me too. Very hard to trade. My female broker has been pouting all year.

>>	Anonymous Mon Mar 6 21:34:59 2023 No.53958179 >>53958149 You are retarded because you are short ebay and i love ebay

>>	Anonymous Mon Mar 6 21:35:24 2023 No.53958189 >>53958136 >doesn’t know about SKYT Way ahead of you, ranjesh

>>	Anonymous Mon Mar 6 21:35:33 2023 No.53958192 >>53958168 Sounds a bit misogynistic honey. https://www.youtube.com/watch?v=NeQM1c-XCDc

>>	Anonymous Mon Mar 6 21:36:02 2023 No.53958196 >>53958179 fuck ebay MCARY MCARY MCARY

>>	Anonymous Mon Mar 6 21:36:03 2023 No.53958197 >>53958189 My name is Craig.

>>	Anonymous Mon Mar 6 21:37:03 2023 No.53958205 >>53958197 do you pronounce that 'cregg' or the right way?

>>	Anonymous Mon Mar 6 21:37:06 2023 No.53958206 File: 137 KB, 707x1000, 1674743617100081.jpg [View same] [iqdb] [saucenao] [google] >>53958178 Same.

>>	Anonymous Mon Mar 6 21:37:06 2023 No.53958207 >>53958179 Not an argument

>>	Anonymous Mon Mar 6 21:37:20 2023 No.53958211 >>53958168 Someone had to tell the voices in my head what to do. https://www.youtube.com/watch?v=W1PNvopXjbg

>>	Anonymous Mon Mar 6 21:37:47 2023 No.53958215 File: 838 KB, 648x728, file.png [View same] [iqdb] [saucenao] [google] inflation is over

>>	Anonymous Mon Mar 6 21:38:40 2023 No.53958224 >>53958196 NEVERRRRRRRRRRRRRRRRRRRRRRRR MCARY REEEEEEEEEEEEEEEEEEEEEEE

>>	Anonymous Mon Mar 6 21:38:42 2023 No.53958225 >>53958205 The correct way, only in America do they pronounce it like that. I don't know why.

>>	Anonymous Mon Mar 6 21:38:43 2023 No.53958226 Bearbros, why is SPY going up? Doesn't SPY-sama know JPow-sana is speaking tomrrow desu senpai baka?

Anonymous Mon Mar 6 21:38:50 2023 No.53958228

>>53957919
Lol, big seethe from the poo. I’m not invested in uranium, by the way. That would be dumb considering pellet reactors use recycled fissile material. I’m mad bullish on power companies though. Their overhead is going to get completely subsidized by the government.

>>	Anonymous Mon Mar 6 21:39:14 2023 No.53958229 File: 350 KB, 220x264, Jefferson.gif [View same] [iqdb] [saucenao] [google] >>53958215

>>	Anonymous Mon Mar 6 21:39:19 2023 No.53958231 >>53958215 SHUT THE FUCK UP ANON NOW EVERYONE IS GONNA KNOW

>>	Anonymous Mon Mar 6 21:39:23 2023 No.53958233 >>53958225 they also think 'Graham' is 'gram' fucking retards, and i have to live among them

Anonymous Mon Mar 6 21:39:38 2023 No.53958236

>>53958156

Actually this is much more likely than the US doing it via the CHIPS act like we are trying now. We are not capable of building a semi fab workforce that is exclusively 130+ IQ, Japan is. And China might get Taiwan, but never Japan.

To be clear: the talent exists within the US, but nepotism and woke political bullshit will prevent any real meritocracy. So Japan is a likely replacement for Taiwan once our bungling attempts are reproducing TSMC inevitably fail, because it turns out pedro and shaneequa can't design chips or run lithography machines worth a god-damn.

>>	Anonymous Mon Mar 6 21:40:14 2023 No.53958241 File: 12 KB, 306x436, secret_candles.jpg [View same] [iqdb] [saucenao] [google] >>53957857 how are you supposed to trade this? how is this legal?

>>	Anonymous Mon Mar 6 21:40:16 2023 No.53958243 >>53958197 Whoops, sorry. Go on about your business. I found the turd-man I was looking for anyway.

>>	Anonymous Mon Mar 6 21:40:54 2023 No.53958255 >>53958215 I want to fertilize those eggs iykwim

>>	Anonymous Mon Mar 6 21:41:00 2023 No.53958256 >>53958211 Based. https://www.youtube.com/watch?v=KDHd-vxcMDo

>>	Anonymous Mon Mar 6 21:41:16 2023 No.53958258 >>53958233 How else would you say it

>>	Anonymous Mon Mar 6 21:41:23 2023 No.53958260 File: 459 KB, 1656x1242, Fqi89TAXwAM8-0d.jpg [View same] [iqdb] [saucenao] [google] >>53957857

>>	Anonymous Mon Mar 6 21:41:30 2023 No.53958261 File: 109 KB, 1121x596, Eggs.jpg [View same] [iqdb] [saucenao] [google] >>53958215 Why can't Americans into eggs? They look like they have zero nutritional value. https://www.clarencecourt.co.uk/our-eggs/egg-range/

>>	Anonymous Mon Mar 6 21:42:01 2023 No.53958265 File: 194 KB, 627x573, english.png [View same] [iqdb] [saucenao] [google] >>53958258 "gramme"

>>	Anonymous Mon Mar 6 21:42:09 2023 No.53958269 >>53958241 If you wanted a real market maybe your great grandpa shouldn't have stopped that Austrain artist with the funny mustache

>>	Anonymous Mon Mar 6 21:42:24 2023 No.53958271 File: 90 KB, 1170x1048, B8330502-A90D-477B-B06A-31ADBB72999A.jpg [View same] [iqdb] [saucenao] [google] >>53958107 Damn I missed it

>>	Anonymous Mon Mar 6 21:42:33 2023 No.53958273 File: 551 KB, 664x923, pogkpdfkg.png [View same] [iqdb] [saucenao] [google] >>53958258 'grey em'

>>	Anonymous Mon Mar 6 21:42:35 2023 No.53958274 File: 439 KB, 648x826, Screen Shot 2023-03-06 at 2.41.12 PM.png [View same] [iqdb] [saucenao] [google] >>53958261 Costco offers brown eggs for a higher price. >>53958241 Be part of the club, obviously.

>>	Anonymous Mon Mar 6 21:42:36 2023 No.53958275 File: 23 KB, 500x353, 1676074191812994.jpg [View same] [iqdb] [saucenao] [google] Does anyone have source to that manga where the female broker acts all tsundere and stuff? I am feeling a bit broken today and need something cushy

Anonymous Mon Mar 6 21:43:02 2023 No.53958282
File: 181 KB, 858x823, 1678135791906468.jpg [View same] [iqdb] [saucenao] [google]

>>53958226
Don't know why in particular. I don't deal in why though. I just do what line says. Today chart shifted from likely bear market rally to iffy crabby not sure and therefore i had to abandon my conservative position of 100% sqqq for a measly 3% profit.
pic related my female broker's intern

>>	Anonymous Mon Mar 6 21:43:09 2023 No.53958285 File: 395 KB, 755x460, penguin eggs.png [View same] [iqdb] [saucenao] [google] >>53958261 you could sell these bad boys for major cash

>>	Anonymous Mon Mar 6 21:43:22 2023 No.53958287 >>53957989 People keep buying Mcd even though it's not even cheap anymore, it was never about the prices

>>	Anonymous Mon Mar 6 21:43:37 2023 No.53958289 Market red tomorrow, not financial advice

>>	Anonymous Mon Mar 6 21:43:39 2023 No.53958290 >>53958215 This is literally my 16year old niece

>>	Anonymous Mon Mar 6 21:45:00 2023 No.53958306 DOLE earnings tomorrow premarket banana bros.

>>	Anonymous Mon Mar 6 21:45:12 2023 No.53958309 >>53958207 yeah sorry my man I dont have any real advice on those tickers I havent been studying those ones, but given the general environment I can understand being short HAS and LULU

>>	Anonymous Mon Mar 6 21:46:08 2023 No.53958319 >>53958306 looks like someone got it early

>>	Anonymous Mon Mar 6 21:46:17 2023 No.53958321 Today BOIL got hit with some light profit taking. Just some minor retracing is all but tomorrow we will be right back on track to higher highs this week :)

>>	Anonymous Mon Mar 6 21:46:54 2023 No.53958327 >>53958282 She looks like a slut

Anonymous Mon Mar 6 21:47:09 2023 No.53958332
File: 245 KB, 1484x762, FqkLFyyXsAgODI4.jpg [View same] [iqdb] [saucenao] [google]

>>53957857
https://www.foxbusiness.com/technology/amazon-go-stores-close-cities-coast-coast

https://www.businessinsider.com/amazon-go-stores-closing-nyc-san-francisco-seattle-2023-3

I thought it was weird how AMZN was dumping today but I can see it dropping even more for the rest of this week and maybe this month. I have a feeling that Bezos pulled the plug behind the scenes and now we are seeing the whole company slowly spiral down. How does a corporation that big come out so shit after their golden age during the pandemic?

>>	Anonymous Mon Mar 6 21:47:35 2023 No.53958335 >>53957989 yeah i used to look at a mcd's meal and say 'fuck that, could go to a sit down for that' and then i actually went to a sit down in 2022 lol

>>	Anonymous Mon Mar 6 21:47:56 2023 No.53958336 >>53958327 in training

>>	Anonymous Mon Mar 6 21:48:11 2023 No.53958337 if you're not daytrading nasdaq futures you're probably gaytrading homo shit dork

>>	Anonymous Mon Mar 6 21:48:32 2023 No.53958340 >>53958215 aaaaaaaaaannnddd the eggs are all sold out.

Anonymous Mon Mar 6 21:48:38 2023 No.53958341

>>53957919
Quite a surprise to find out that CRBPajeet has any profitable trades to show. Between your SAVA shorts, the nonsense volga spam, and the time you thought it was a good idea to go long SIGA spreads 6 months out into December at the peak of that pump, I just assumed your performance is irredeemable.
Congratulations.

>>	Anonymous Mon Mar 6 21:49:51 2023 No.53958356 >>53958261 i prefer great value eggs made from chickens that have never seen the light of day crammed into an area with over 9000 chickens per sq/m animal products should be illegal

Anonymous Mon Mar 6 21:50:06 2023 No.53958359

>>53958332
Why is it going down at all considering it's the biggest online store there is. What other online store is out there that can provide such competition that can even do that to amazon? Is it just the result of looming inflation/recession that's doing it?

>>	Anonymous Mon Mar 6 21:50:41 2023 No.53958363 >>53958335 I almost got a heart attack when I went to McDonalds (UK) and a double cheesburger and six nuggets cost £5.88 = $7.05, like what the fuck.

>>	Anonymous Mon Mar 6 21:50:47 2023 No.53958364 >>53958332 Sucks because I actually use Amazon, I couldn't give less of a shit about the other tech companies since I don't use Facebook or watch Netflix or have Windows etc

Anonymous Mon Mar 6 21:51:18 2023 No.53958370
File: 2.34 MB, 576x1024, Day in the Life - Weeb.webm [View same] [iqdb] [saucenao] [google]

>>53958332
>How does a corporation that big come out so shit after their golden age during the pandemic?
Mediocre tangible products made in China, abysmal customer service, and terrible original Prime Video offers (other than ZeroZeroZero).
Still a decent bookstore if you can't find a discount brick & mortar option near your place. Most listed used books are in great quality.

>>	Anonymous Mon Mar 6 21:52:14 2023 No.53958379 File: 100 KB, 1128x655, Eggy.jpg [View same] [iqdb] [saucenao] [google] >>53958285 A man of very discerning taste. How about an Ostrich egg as well?

Anonymous Mon Mar 6 21:52:39 2023 No.53958382
File: 776 KB, 1080x1960, Screenshot_20230306-215036.png [View same] [iqdb] [saucenao] [google]

I thought smg rated this fuck. He's already turning bullish after being ultra bearish for months.
https://www.zerohedge.com/markets/michael-wilson-turns-tactically-bullish-sees-sp-rising-4150

Anonymous Mon Mar 6 21:52:41 2023 No.53958383

>>53958356
This is actually the very reason I raise my own chickens, the only way to be sure the eggs came from a good place and the chickens had a good chicken life is to take matters into your own hands and do it yourself (or stop eating eggs which i will not do)

>>	Anonymous Mon Mar 6 21:52:58 2023 No.53958386 >>53958337 rude

>>	Anonymous Mon Mar 6 21:54:49 2023 No.53958411 >>53958386 DAYTRADE NASDAQ FUTURES NOOOOOOOOW

Anonymous Mon Mar 6 21:55:28 2023 No.53958414

>>53958370
Yeah Prime Video is terrible now - all the licences expired on the shit I watch, xfiles, star trek, loads of movies. Then they have that retarded LoTR show.

I dunno, I still use Amazon for all my online orders. I find their delivery to be very good. But it is flooded with tons of chink shit, and it's not a very good website to "browse" for things, you need to know what you want. They also wasted loads of money on pointless crap like alexa.

>>	Anonymous Mon Mar 6 21:55:32 2023 No.53958415 >>53958206 damn wish I had a cute coworker with thick legs at the office. Maybe even be top heavy too and I'd love my job everyday.

>>	Anonymous Mon Mar 6 21:56:03 2023 No.53958422 >>53958359 Could be decentralizing, ordering shit directly from somewhere and cutting out the middle man with Fed Ex and UPS

Anonymous Mon Mar 6 21:56:20 2023 No.53958425

>>53958335

The fast food to watch is Sonic. Where else can you get chili cheese tater tots, soft pretzel and cheese dip, all-day sausage/egg/cheese croissant, popcorn chicken, and a cherry limeade to drink all in the same place, and have the food brought over to your parked car by a cute white girl? Exactly: no where else.

Unfortunately: https://en.wikipedia.org/wiki/Inspire_Brands
these guys don't seem to be public. Damn shame.

>>	Anonymous Mon Mar 6 21:56:20 2023 No.53958426 >>53958411 I don't have the money to buy even one futures contract on margin.

>>	Anonymous Mon Mar 6 21:56:46 2023 No.53958431 >>53958379 how devilishly delectable

>>	Anonymous Mon Mar 6 21:56:55 2023 No.53958437 life is a blast when you know what you're doing best to know what you're doing 'fore your life get ruined >https://www.youtube.com/watch?v=vG5La6k6eTI

>>	Anonymous Mon Mar 6 21:57:49 2023 No.53958447 >>53958426 THAT'S AWFUL MAN YOU GOTTA CHANGE THAT

>>	Anonymous Mon Mar 6 21:58:13 2023 No.53958454 >>53958425 their food is garbage, except i do like that garlic butter burger they do seasonally they do have some cute white girls tho

Anonymous Mon Mar 6 21:58:19 2023 No.53958456

>>53958359
IIRC Walmart is actually beating AMZN in online sales. I couldn't believe it either, but they are. If you notice, AMZN doesn't do 'free 2 day shipping' with Prime anymore(doesn't even show up in checkout) and their shipping has been getting worse since 2022(literally took a month to ship a pair of shoes).

That and I noticed almost everything is more expensive now too. Why would I pay $40 for 180 count fish oil bottle when I could go to Walmart and get the same brand for 50% cheaper?

Anonymous Mon Mar 6 21:58:20 2023 No.53958457

>>53958382
>at least for the near term - and writes that "equity markets survived a crucial test of support last week that suggests this bear market rally is not ready to end just yet" and concluding that "we could see further upside if the US dollar and interest rates continue their fall from Friday with next resistance for the S&P 500 at 4150 under such conditions."
>markets "reacted strongly from those levels, which suggests this will not be a one day wonder and the bear market rally is not yet over." Here is a snapshot of Wilson's technical observations"
>First, while our comments will focus on the S&P 500, these observations apply to most of the other major indices as well--i.e., the Nasdaq, Russell 2000 and the Dow Industrials, which remains the weakest of the bunch, in our view. First, in Exhibit 1 one can see that the key support was tested severely over the past few weeks but on Friday, the market reacted strongly around the second test. We have to respect that successful test and now need to try and decide what it means.
>this rally may still be on borrowed time despite the impressive price action on Friday.
>We showed this trendline in prior notes and continue to think it is critical that the S&P 500 get back above it to confirm a new bull market. As shown in Exhibit 2, this trendline has provided critical resistance and support over the past 14 years during this secular bull market. More recently, it has been more of a resistance line and that level comes in today at around 4150. While we think the S&P 500 could make another attempt at this key resistance, it will require 2 things in particular to surmount it--lower 10-year US Treasury yields and a weaker dollar. In fact, we think Friday's sharp fall in 10-year yields was an important driver of Friday's bounce in stocks. The dollar, too, showed some signs of exhaustion and it would be helpful if it can decline more meaningfully.
He hasn't turned bullish, he just thinks that we will test 4150 again

>>	Anonymous Mon Mar 6 21:59:33 2023 No.53958469 >>53958456 >and their shipping has been getting worse since 2022 This undeniable though, I don't even bother with prime anymore

>>	Anonymous Mon Mar 6 21:59:39 2023 No.53958471 >>53958356 Their all white, with all their frens, no rain, no cold, free food. We all should be so lucky.

Anonymous Mon Mar 6 21:59:54 2023 No.53958476

>>53958382
>>53958457
he just thinks that we will test 4150 again, if yields continue to fall and dollar continues to fall
that we'll test this longterm post GFC trendline to the upside again, in a bear market rally
>our view remains the same-the bear market is not over--but we acknowledge that Friday's price action may extend it a few more weeks. Time will tell.
he just thinks the bear market rally will go on for some more time before fizzling
and I agree - if yields fall, dollar falls, the bear market rally will continue

>>	Anonymous Mon Mar 6 22:00:00 2023 No.53958477 File: 24 KB, 390x553, 5648971.jpg [View same] [iqdb] [saucenao] [google] MARKET GO UP 0DTE PUTS AT HALFTIME MARKET GO DOWN 0DTE CALLS AT HALFTIME CLOSE POSITION 45 MINUTES BEFORE CLOSE ITS A REAL LIFE MONEY GLITCH

>>	Anonymous Mon Mar 6 22:00:19 2023 No.53958479 >>53958456 >AMZN doesn't do 'free 2 day shipping' with Prime anymore Wut? In the UK prime = free next day delivery on most items.

>>	Anonymous Mon Mar 6 22:00:49 2023 No.53958490 >>53958456 >Why would I pay $40 for 180 count fish oil bottle when I could go to Walmart and get the same brand for 50% cheaper? And you can get it the same day too. I hate waiting for shit in the mail.

>>	Anonymous Mon Mar 6 22:02:00 2023 No.53958515 >>53958370 It would be really funny if they did dial back down to being a bookstore again when their debt gets way too big to pay off.

>>	Anonymous Mon Mar 6 22:02:22 2023 No.53958517 >>53958477 Die.

Anonymous Mon Mar 6 22:03:41 2023 No.53958534

>>53958335
I don't go to any of them anymore unless I get a really good coupon. I stockpile pintos, corn (together they form a complete protein), brown rice, canned collards (KR brand is the only one with no added ingredients, otherwise I do all Great Value), peanut butter, etc.

>>	Anonymous Mon Mar 6 22:03:45 2023 No.53958535 >>53958479 The UK is also the size of Michigan

>>	Anonymous Mon Mar 6 22:03:52 2023 No.53958537 >>53958479 Really? In the USA, its impossible to get that option here which sucks. I used to use Prime shipping to get physical copies of video games on release, but not anymore.

Anonymous Mon Mar 6 22:04:47 2023 No.53958552
File: 29 KB, 393x350, 1664479791229048.jpg [View same] [iqdb] [saucenao] [google]

>>53958454

Garbage is a little harsh, but yes everything they do somebody else does better, except maybe the drink variety.

The appeal is just the sheer variety. For some reason bouncing around between 5 different menu items makes them all taste better. It's like the cheerleader effect cept for food, idfk how to explain it.

Anonymous Mon Mar 6 22:05:48 2023 No.53958563
File: 96 KB, 1024x944, 1652465598187.jpg [View same] [iqdb] [saucenao] [google]

I shan't listen to the Morgan Stanley exec.
>>53958515
Depends if people want to buy all the leftist-edited nu-versions of classics.
>Augustus Gloop is no longer considered "fat" in Charlie and the Chocolate Factory

>>	Anonymous Mon Mar 6 22:06:29 2023 No.53958570 I was going to sell covered calls today but forgot

>>	Anonymous Mon Mar 6 22:07:26 2023 No.53958579 >>53958535 Aye, I'm just saying. Still I would have thought it would be better than 2+ days, unless you live in the middle of nowhere.

Anonymous Mon Mar 6 22:10:04 2023 No.53958608
File: 409 KB, 1860x1600, -arZHc3gu.jpg [View same] [iqdb] [saucenao] [google]

Speaking of AMZN
>Amazon, $AMZN, is letting employees use their stock to finance home purchases and even second homes, per TechCrunch
>Now, Amazon employees have the option to help improve their chances of getting a loan for buying their house. Instead of coming up with the typical down payment, employees can use their vested equity as collateral to get a downpayment for their home purchase.

Amazon is allowing this in order to have complete control over their employees. Not productive enough and stock goes down? Well, you now owe thousands more on your mortgage. Its pretty fucked and will create more housing bubbles because the huge drop in AMZN share price is already causing decreases in worker salaries right now.

>>	Anonymous Mon Mar 6 22:11:46 2023 No.53958623 File: 102 KB, 900x642, Divvies are irrelevant.jpg [View same] [iqdb] [saucenao] [google] Threadly reminder that dividends are irrelevant. If you want a bit of cash from your stocks, you can sell some.

Anonymous Mon Mar 6 22:13:05 2023 No.53958639
File: 1.73 MB, 1169x1680, 1660078740055618.png [View same] [iqdb] [saucenao] [google]

I still get free 2-day shipping on nearly everything from Amazon, and in some cases next day shipping. What are you guys buying from them that you can't get 2-day shipping on?
>>53958608
Awooooga

>>	Anonymous Mon Mar 6 22:14:08 2023 No.53958649 >>53958623 ok mr broker guy who lives off commission

Anonymous Mon Mar 6 22:15:49 2023 No.53958662 [DELETED]

I was banned for making the following post, and then all of my posts were deleted, for anyone who is curious what the CORRUPT FAGGOT MODS are up to and why 4chan has turned into low IQ mainstream bullshit for Reddit politicos now. It's because CORRUPT PIECES OF SHIT are curating discussion for political pov:

>a bunch of retarded faggots learn the theory that systemic emergences can lead to inequitable outcomes
>proceed to petulantly defend the system no matter what because it's the system that gives them privilege

Sorry for talking about you and hurting your feelings, you glowfaggot pile of shit with no respect for the rights of others who is bringing your glowfaggot autocratic shadowbanning from Reddit to 4chan now. You bootlicking, powertripping fly on a faggots turd. You literally state socialist literal Nazi.

Anonymous Mon Mar 6 22:17:15 2023 No.53958678

>some random dude in here says to buy trka when it was at like .2 because it'll hit .7
>throw 1k at it
>forget about it
>get a notification my limit sell activated today

And this is why I'm up 80k after an initial deposit of 500, because I take advice from 1 post by this id posters

>>	Anonymous Mon Mar 6 22:17:28 2023 No.53958682 File: 27 KB, 344x535, SIGApacifico.jpg [View same] [iqdb] [saucenao] [google] job offer / drug test anon here. i passed the test last week and completed my first day on the new job today cheers lads; i'm having a cold one tonight

>>	Anonymous Mon Mar 6 22:18:53 2023 No.53958695 >>53958682 Based, I told you to take it easy

>>	Anonymous Mon Mar 6 22:19:07 2023 No.53958700 >>53958682 Grats. Hopefully it will fuel your portfolio very nicely.

Anonymous Mon Mar 6 22:19:27 2023 No.53958703
File: 187 KB, 500x502, 1676181586594991.jpg [View same] [iqdb] [saucenao] [google]

I'm sorry for being a retard but with oil, commodities, and food this expensive, how in the hell are they going to bring inflation down without some aggressive rate hikes or other measures?
At least Powell is doing something but I feel like Europe is just fucked with how things stand right now.
The latest statistics once again showed everything getting more expensive and core inflation showing no sings of stopping, yet people don't seem to give a crap anymore... more profit for big companies and banks while the ordinary person is getting fisted up the arse. And the worst thing is that this person won't even blame the banks.
I went to a presentation hosted by a significant bank, bunch of normies, you know the drill... and guess what? The bank made it fuckin seem like the economy was pretty alright and everything can be blamed on Putin, and they ate it all up.

>>	Anonymous Mon Mar 6 22:21:15 2023 No.53958716 File: 249 KB, 561x561, 1677099240779542.png [View same] [iqdb] [saucenao] [google] WHERE THE HELL are my AI generated finance waifus? I'd rather have that than people arguing about BOIL all day long.

>>	Anonymous Mon Mar 6 22:21:26 2023 No.53958720 >>53958341 >nd the time you thought it was a good idea to go long SIGA spreads yall just make shit up now?

>>	Anonymous Mon Mar 6 22:22:20 2023 No.53958733 File: 276 KB, 1000x1000, 1678064424909438.jpg [View same] [iqdb] [saucenao] [google] >>53958678 >when it was at like .2 because it'll hit .7 >throw 1k at it >And this is why I'm up 80k Bruh ong this math aint mathin. That should only be a 3.5x

Anonymous Mon Mar 6 22:22:53 2023 No.53958740
File: 457 KB, 2560x1707, 1663776699728853.jpg [View same] [iqdb] [saucenao] [google]

> bring inflation down
Woah hold on there hothead. I don't like this attitude. I think we should consider a possibility that i6% inflation is actually good for the economy before we do somethind stupid. I'll give more updates on this later.

>>	Anonymous Mon Mar 6 22:23:03 2023 No.53958744 >>53958678 Your math seems a little funny but I'm happy for you anon

>>	Anonymous Mon Mar 6 22:23:20 2023 No.53958748 >>53958733 >small brain detected he's saying he makes trades like this often where he follows 1 post by this ID shills, where he throws money at ideas generated by /smg/, and that is why he is up so much

Anonymous Mon Mar 6 22:23:56 2023 No.53958753
File: 3.02 MB, 2067x1236, Les Bogs 11.png [View same] [iqdb] [saucenao] [google]

>>53958703
>how in the hell are they going to bring inflation down
Stop printing money every single day (but that won't ever happen under this regime).
>>53958716
Best I can do is hook you up with them.

>>	Anonymous Mon Mar 6 22:24:03 2023 No.53958755 >>53958733 That's overall, not off of that one transaction dummy

>>	Anonymous Mon Mar 6 22:24:29 2023 No.53958760 File: 428 KB, 1242x1129, chess master.jpg [View same] [iqdb] [saucenao] [google] >>53958649 I have no idea what you're talking about, anon...

>>	Anonymous Mon Mar 6 22:25:19 2023 No.53958768 >>53958382 Do you realize that smg rates the biggest fucking moron schizo contrarians out there? From zerohedge to Greg Marinara, smiggers have consistently latched onto retards

>>	Anonymous Mon Mar 6 22:26:15 2023 No.53958777 >>53958703 >but I feel like Europe is just fucked with how things stand right now. They're pretty fucking dumb, I think they were anticipating a harsher winter and it didn't happen so they just got a big head

>>	Anonymous Mon Mar 6 22:26:25 2023 No.53958779 >>53958425 The white girls at sonic are not as cute as the white girls working for Target (Ticker symbol TGT)

>>	Anonymous Mon Mar 6 22:26:26 2023 No.53958780 File: 501 KB, 600x600, 1677102888065810.gif [View same] [iqdb] [saucenao] [google] >>53958753 >Best I can do is hook you up with them Well, if that really is the best you can do, I guess that will do. But I'm not happy about it, mind you.

>>	Anonymous Mon Mar 6 22:28:13 2023 No.53958793 File: 103 KB, 999x563, 1670256432994610.jpg [View same] [iqdb] [saucenao] [google] >>53958780 wo(man) of culture I see

>>	Anonymous Mon Mar 6 22:28:48 2023 No.53958799 >>53958779 The cutest wagies where I live are at Chick Fil A for some reason, I live in a fairly white area though so that restaurant isn't filled with black people and I'm also not in the south

>>	Anonymous Mon Mar 6 22:29:15 2023 No.53958805 File: 38 KB, 1078x161, CRBPajeet.png [View same] [iqdb] [saucenao] [google] >>53958720 There is evidence.

>>	Anonymous Mon Mar 6 22:29:28 2023 No.53958806 File: 147 KB, 800x800, Selena1.jpg [View same] [iqdb] [saucenao] [google] What stocks does she own?

>>	Anonymous Mon Mar 6 22:30:18 2023 No.53958814 >>53958806 LOVE I bet she bought it in 2020 too

>>	Anonymous Mon Mar 6 22:30:38 2023 No.53958815 File: 2.04 MB, 640x800, femalebrokerdance.webm [View same] [iqdb] [saucenao] [google] >>53958716 Here is a live stream of my female broker dancing when she gets a juicy commission

Anonymous Mon Mar 6 22:30:41 2023 No.53958817
File: 14 KB, 500x590, 1601346149138.png [View same] [iqdb] [saucenao] [google]

>>53958805
who is that. wtf kind of brokerage platform is that. i have done some retarded trades on /smg/ but anything to do with SIGA is not one of them. I was just SIGA GAY SEX BROS posting with soijaks through it all

Anonymous Mon Mar 6 22:33:58 2023 No.53958836

>>53958799
The white wagie girls at Starbucks are all fat as fuck and ugly. I used to live in a super white area and the Starbucks white girls there were always like 2 standard deviations uglier.

The white girls at Applebees are fucking great though. Wild as shit. Used to fuck one with a perky ass and mild bipolar disorder who would tell me about how dysfunctional her Applebees was

>>	Anonymous Mon Mar 6 22:37:13 2023 No.53958864 File: 496 KB, 245x150, Landa.gif [View same] [iqdb] [saucenao] [google] >>53958806 >Check her Linkedin >Bartender, Dance Instructor, Brand Ambassador >>53958815 Give Rogue from X-Men gf plz

>>	Anonymous Mon Mar 6 22:37:14 2023 No.53958865 >>53958753 This feels like a baggie post ... Not an insult I like baggie

>>	Anonymous Mon Mar 6 22:37:38 2023 No.53958869 File: 29 KB, 600x337, smug_kold_king.jpg [View same] [iqdb] [saucenao] [google] lmaoing at BOIL baggies today... i guess that's why they call it the widow maker for a reason... doesn't really work if these guys are virgins though

>>	Anonymous Mon Mar 6 22:39:16 2023 No.53958889 https://archived.moe/biz/thread/53957857/#53958662

>>	Anonymous Mon Mar 6 22:42:59 2023 No.53958925 File: 739 KB, 640x895, 1677973787066620.png [View same] [iqdb] [saucenao] [google] You. Are. Warned. The bull run. He is bringing it to your doorstep. With a side of habanero.

>>	Anonymous Mon Mar 6 22:44:12 2023 No.53958939 anybody know what they are charging at KFC for a double down?

>>	Anonymous Mon Mar 6 22:45:26 2023 No.53958948 File: 1.50 MB, 1190x1092, Screen Shot 2023-03-06 at 3.27.14 PM.png [View same] [iqdb] [saucenao] [google] How do I profit off of police no longer returning fire?

>>	Anonymous Mon Mar 6 22:51:20 2023 No.53958995 Test

>>	Anonymous Mon Mar 6 22:53:18 2023 No.53959020 https://archived.moe/biz/thread/53957857/#53958662

>>	Anonymous Mon Mar 6 22:54:39 2023 No.53959040 BOIL BOIL BOIL IM LIQUIDATED I CRY AHHHHHHHHH

>>	Anonymous Mon Mar 6 22:55:05 2023 No.53959052 >>53958939 I didn't even know they still had those

>>	Anonymous Mon Mar 6 22:56:05 2023 No.53959061 >>53959040 >the widowmaker

>>	Anonymous Mon Mar 6 22:57:14 2023 No.53959072 >>53958925 Tell me about the Mango Habanero Sauce Company. Why is it at 15x Revenues.

Anonymous Mon Mar 6 22:59:36 2023 No.53959100

Alright holy fuck milkbreaths. I just joined a free finance gurus discord server because my irl friend joined it and i want to see just how bad my bud is gonna get dumped on.

This options furu retard was say vanna exposure is bigger than gamma exposure in the 0DTE SPX markets(when ATM options have the biggest notional size.) he also runs a fund kek. The guy was alluding to the market being the most volatile when were in negative gamma territory but the data says otherwise(zero gamma is when markets are most volatile.)

Seems to be all the rage... self-anointed fund managers who think ... that “Theta” is the edge … or ... selling puts / buying calls creates a “Quasi-Free Call”... we should really encourage more of this. Lol.

>>	Anonymous Mon Mar 6 23:00:53 2023 No.53959112 >>53959100 do you even arbitrage bro

>>	Anonymous Mon Mar 6 23:01:41 2023 No.53959123 >>53958703 They won't. Hence why it climbed after powell lowered it to baby 25 hikes

Anonymous Mon Mar 6 23:02:02 2023 No.53959127
File: 51 KB, 149x540, Holding List 2023 - Till Death.jpg [View same] [iqdb] [saucenao] [google]

Another day. Another day of green. Another day of "doing nothing" and getting paid for it. Almost had an accident this morning. Fucking almost fell on my ass over a cat toy. Was in a hurray and stepped on it. (ball). So yeah.

>>	Anonymous Mon Mar 6 23:02:39 2023 No.53959133 >>53958477 This wouldve wiped you out last week.

>>	Anonymous Mon Mar 6 23:02:58 2023 No.53959142 >>53958695 >>53958700 thanks lads >hey bro can i borrow some clean piss

>>	Anonymous Mon Mar 6 23:05:19 2023 No.53959158 File: 201 KB, 744x536, Miu huh.jpg [View same] [iqdb] [saucenao] [google] BOIL is so fucking flat oh my god. I dont know if this is good or bad going into the rest of the week

>>	Anonymous Mon Mar 6 23:06:29 2023 No.53959179 File: 210 KB, 1280x1352, nana_suffer.jpg [View same] [iqdb] [saucenao] [google] I've had to do so much work over the last 2 weeks I have no clue where the market is or what it is doing.

>>	Anonymous Mon Mar 6 23:07:08 2023 No.53959185 >>53959112 bro selling SPX puts while buying SPY shares is risk free arbitrage

>>	Anonymous Mon Mar 6 23:07:42 2023 No.53959196 File: 23 KB, 474x266, 1677789887152094.jpg [View same] [iqdb] [saucenao] [google] >>53959179 SPY will NEVER go below 393 EVER AGAIN. Hopefully you can get in on a pullback while you still can.

>>	Anonymous Mon Mar 6 23:07:50 2023 No.53959197 >>53959179 Bullshit jew market like usual

>>	Anonymous Mon Mar 6 23:08:09 2023 No.53959204 >>53958682 What fucking job are you taking that requires a piss test?

>>	Anonymous Mon Mar 6 23:08:21 2023 No.53959205 >>53959020 JANNIE THIS POST IS DANGEROUS FOR OUR DEMOCRACY JANNIIIEEE HEELLLPPP

>>	Anonymous Mon Mar 6 23:08:31 2023 No.53959209 https://archived.moe/biz/thread/53957857/#53958662

>>	Anonymous Mon Mar 6 23:09:00 2023 No.53959213 >>53959209 THEY KEEP COMING GLOWIEBROS IT'S OVER

>>	Anonymous Mon Mar 6 23:09:55 2023 No.53959225 >>53959204 >What fucking job are you taking that requires a piss test? i sell cybersecurity to the department of defense, basically

>>	Anonymous Mon Mar 6 23:10:58 2023 No.53959232 >>53959158 braps been defeated

>>	Anonymous Mon Mar 6 23:12:16 2023 No.53959243 >>53959158 Sub 5$ by next week

>>	Anonymous Mon Mar 6 23:14:03 2023 No.53959255 File: 74 KB, 1822x370, Screenshot 2023-03-06 at 3.13.44 PM.png [View same] [iqdb] [saucenao] [google] I think I am the least autistic smigger.

>>	Anonymous Mon Mar 6 23:15:02 2023 No.53959261 >>53959020 >>53959205 >>53959209 >>53959213 The glowniggers are using the "boiling frog" approach to slowly turn 4chan into another reddit. If they did it all at once then everyone would leave for another site.

>>	Anonymous Mon Mar 6 23:17:17 2023 No.53959275 File: 357 KB, 496x632, 7452165847608.png [View same] [iqdb] [saucenao] [google] >>53958306 Alarm is set. Wouldn't miss it for all the tea in China. Bananas to the moon!

Anonymous Mon Mar 6 23:19:42 2023 No.53959293

>>53958817
Looking more closely, you're right. The dark theme is similar but its clearly a different platform that looks kind of mobile app inspired, whereas the DNN trade looks like some typical desktop-based platform such as tastytrade. As an IBKR user myself, all I can say with confidence is that it's not the TWS platform.
I've always thought that SIGA trade must've been you. Managing to lose money with complex option spread plays against a simple pump and dump feels like such a typical 150 iq jeet play that I just assumed it was you.

I was going to apologize, but in looking more closely there are glaring issues with the DNN trade screenshot. P/L Open is listed twice and P/L Day has the same value. DNN hasn't traded above $1.70 since last April and yet the screenshot is marked with today's date. The P/L numbers and percentage only add up if using DNN's Friday close as the reference present day share price, and shorting exactly 19005 shares is pretty odd in itself. So on the whole, that's either a really garbage platform and using outdated data, or the whole screenshot is a forgery.

>>	Anonymous Mon Mar 6 23:23:24 2023 No.53959316 >>53959225 and you must piss over it for it to work thus requiring pure urine?

>>	Anonymous Mon Mar 6 23:24:44 2023 No.53959329 >>53959316 its just a standard drug test that alot of corporate jobs require before hiring you

>>	Anonymous Mon Mar 6 23:25:11 2023 No.53959336 >>53958425 >these guys don't seem to be public Just like Chick-fil-A, maybe not letting (((shareholders))) control your company is a good thing

>>	Anonymous Mon Mar 6 23:27:54 2023 No.53959362 >>53959261 I do it as a meta troll and because the shitposters are all extremely bad.

>>	Anonymous Mon Mar 6 23:28:08 2023 No.53959368 >>53959329 so what do you piss on in that job?

>>	Anonymous Mon Mar 6 23:29:09 2023 No.53959378 >>53959052 Just got released today for 4 weeks

>>	Anonymous Mon Mar 6 23:29:11 2023 No.53959379 >>53959261 You're a couple years too late

>>	Anonymous Mon Mar 6 23:32:13 2023 No.53959407 File: 466 KB, 800x800, easy.jpg [View same] [iqdb] [saucenao] [google] >check muh BOIL just bought today >up over 4% in the after hours

>>	Anonymous Mon Mar 6 23:32:37 2023 No.53959410 >>53959368 bro. you go to labcorp and piss in the cup and they test it to make sure you're not a drug addict before hiring you. stop trolling

>>	Anonymous Mon Mar 6 23:33:31 2023 No.53959418 File: 1.21 MB, 840x840, 23874658926735.png [View same] [iqdb] [saucenao] [google]

>>	Anonymous Mon Mar 6 23:34:55 2023 No.53959432 >>53959293 >NN hasn't traded above $1.70 since last April and yet the screenshot is marked with today's date. Anon. That is when the trade was opened (to sell)

>>	Anonymous Mon Mar 6 23:35:22 2023 No.53959437 >>53959196 But you're saying it'll go to 393, giggity

>>	Anonymous Mon Mar 6 23:35:56 2023 No.53959442 >>53959407 Falling knives, widow makers, etc

>>	Anonymous Mon Mar 6 23:37:33 2023 No.53959453 Holy fucking shit, just opened /BBBY/ general it reminded me of Jan 2021. These people are still talking about dark pools, barcoding, synthetic naked shorting, etc

>>	Anonymous Mon Mar 6 23:38:34 2023 No.53959473 File: 720 KB, 800x868, 1668699935549522.png [View same] [iqdb] [saucenao] [google] Have you guys calmed down yet?

>>	Anonymous Mon Mar 6 23:39:27 2023 No.53959485 >>53957625 >Adolescents with an IQ of 130 were 3-5 times less likely to have had intercourse Wow she's literally talking about me fr fr.

>>	Anonymous Mon Mar 6 23:40:12 2023 No.53959491 File: 82 KB, 910x1024, 1675535860311172.jpg [View same] [iqdb] [saucenao] [google] >>53959473 no

>>	Anonymous Mon Mar 6 23:40:46 2023 No.53959496 File: 1.06 MB, 1732x1317, WJC.jpg [View same] [iqdb] [saucenao] [google] >>53959491 It was wild in here earlier.

Anonymous Mon Mar 6 23:41:20 2023 No.53959501

>>53959442
I will hold till next Winter if need be, and add to it along the way any chance I am able during dips. Then when it moons I will sell and start trying to determine when to buy KOLD. I hope at some point to build up enough to do essentially the same thing with options because I need to leverage my little seed, I am way too old and in straits too dire for waiting on Bogleism.

>>	Anonymous Mon Mar 6 23:43:36 2023 No.53959525 File: 31 KB, 402x604, fatboi.jpg [View same] [iqdb] [saucenao] [google] >futures https://www.youtube.com/watch?v=mMI6ewAkOtY

>>	Anonymous Mon Mar 6 23:44:15 2023 No.53959532 >>53959410 >we just need your piss goyim >for r- research purpose and shieeet some white underage girl is drowned with your piss at the nearest freemason lodge

>>	Anonymous Mon Mar 6 23:45:40 2023 No.53959547 Anyone longing PISS?

>>	Anonymous Mon Mar 6 23:45:51 2023 No.53959550 >>53959532 I would be into donating my piss for this very purpose. Where do I sign up and how do I know it isn't going to be used by some Buffalo Bill type instead?

>>	Anonymous Mon Mar 6 23:46:58 2023 No.53959556 >>53959209 I got banned for saying "The most Jreidh thing I ever done is own bank stocks and profit on the downfall of America". The Mods must not be Kanye fans

>>	Anonymous Mon Mar 6 23:50:00 2023 No.53959593 what is it with titlets and crop tops

Anonymous Mon Mar 6 23:52:48 2023 No.53959627

>>53959432
>Anon. That is when the trade was opened (to sell)
Yes. I am aware.
( 1.77 - 1.23 ) x 19005 = 10262.7
Plug in 1.27 - friday's close - and you get 9312.45. However, the screenshot taken at 1:13 PST is after Monday's close. And all of this is P/L info before share borrow fees of course.

Daily P/L columns typically show profit/loss from movements during the current day. And none of this explains why someone would create a view that displays the same column twice.

Mysterious. Your nitpicking of a single sentence only further adds to the mystery.

>>	Anonymous Mon Mar 6 23:55:26 2023 No.53959660 File: 55 KB, 736x620, 1674956465506013.jpg [View same] [iqdb] [saucenao] [google] JEPI and SPXS!

>>	Anonymous Mon Mar 6 23:55:27 2023 No.53959661 >>53959275 bj class, right? do roasties really?

>>	Anonymous Mon Mar 6 23:55:30 2023 No.53959664 >>53959255 Link?

Anonymous Mon Mar 6 23:55:33 2023 No.53959665 [DELETED]

I was banned for making the following post, and then all of my posts were deleted, for anyone who is curious what the CORRUPT FAGGOT MODS are up to and why 4chan has turned into low IQ mainstream bullshit for Reddit politicos now. It's because CORRUPT PIECES OF SHIT are curating discussion for political pov:

>a bunch of retarded faggots learn the theory that systemic emergences can lead to inequitable outcomes
>proceed to petulantly defend the system no matter what because it's the system that gives them privilege

Sorry for talking about you and hurting your feelings, you glowfaggot pile of shit with no respect for the rights of others who is bringing your glowfaggot autocratic shadowbanning from Reddit to 4chan now. You bootlicking, powertripping fly on a faggots turd. You literally state socialist literal Nazi.

>>	Anonymous Mon Mar 6 23:57:06 2023 No.53959680 File: 112 KB, 1752x834, 1675725325827897.jpg [View same] [iqdb] [saucenao] [google] >>53959665 JFC a one man holocaust.

>>	Anonymous Mon Mar 6 23:57:23 2023 No.53959682 >>53959496 Wtf is this real

>>	Anonymous Mon Mar 6 23:57:40 2023 No.53959683 >>53959660 This doesn't actually sound like a terrible combination

>>	Anonymous Mon Mar 6 23:58:31 2023 No.53959693 Baking.

>>	Anonymous Mon Mar 6 23:58:57 2023 No.53959701 Now a good time to swing about a grand er nah?

Anonymous Mon Mar 6 23:59:49 2023 No.53959711
File: 800 KB, 500x545, dere.gif [View same] [iqdb] [saucenao] [google]

>>53959683
lost money chasing options, and now i'm busier than usual at work. still bearish and all signs point toward a coming "crash". it just makes sense for me to just DCA into those 2 for the time being.

>captcha: prayxp

>>	Anonymous Tue Mar 7 00:00:00 2023 No.53959714 File: 1.45 MB, 1440x1446, 1662004365749984.png [View same] [iqdb] [saucenao] [google] >>53959682 Google Earth Pro. It's a fun program.

Anonymous Tue Mar 7 00:00:15 2023 No.53959720

>>53959660
I sold my SPXS last week and bought JEPI. Today I sold JEPI at $54.20 in anticipation of JPow's jawboning session with the Senate tomorrow. It should be a good time, I will sit in cash until a good direction can be identified. At least cash is yielding an annualized 4.5%

>>	Anonymous Tue Mar 7 00:00:18 2023 No.53959721 >>53959701 BOIL BOIL BOIL FUCK IM DONE FOR I AM A BAGGIE FOR LIFE WAHHHHH BABY CRY

>>	Anonymous Tue Mar 7 00:00:51 2023 No.53959727 >>53959721 Someone get this hothead outta here!

Anonymous Tue Mar 7 00:01:06 2023 No.53959732

What are you guys shorting going into the weeks leading to the FOMC?
Tech is obvious enough ig.
Seems dumb not to take advantage of euphoric bullmutts pumping it to extremes. Also I claim first usage of "bullmutts" , I license it for use through an open creative commons license.

Anonymous Tue Mar 7 00:01:37 2023 No.53959739 [DELETED]

File: 54 KB, 871x268, janny.jpg [View same] [iqdb] [saucenao] [google]

>>53959665
Sometimes you catch a bullshit ban. Unlucky. Complain all you want but it's not going to change anything. Your spam will only lead to some innocent city getting rangebanned.

>>	Anonymous Tue Mar 7 00:01:49 2023 No.53959741 >>53959721 I want to stop being a baggie.

>>	Anonymous Tue Mar 7 00:02:33 2023 No.53959755 >>53959496 Ahh, DC. Last time I was there I was breaking into the Capitol!

>>	Anonymous Tue Mar 7 00:03:09 2023 No.53959759 >>53959721 I wish I could buy more.

>>	Anonymous Tue Mar 7 00:03:49 2023 No.53959768 >>53959682 >>53959496 wtf am I missing here? what city is this a pic of? why is it surprising that this is real?

>>	Anonymous Tue Mar 7 00:04:04 2023 No.53959772 >>53959739 I am permab& on my main. I would like to slice gookmoot and his buttboy mods open and take a dump where their brains are supposed to be. https://vocaroo.com/1dmb0PiAqesv

Anonymous Tue Mar 7 00:04:56 2023 No.53959780 [DELETED]

Oh wow yeah instead getting rid of the abusive shithead mod just threaten us with making the website suck even more dick

I was banned for making the following post, and then all of my posts were deleted, for anyone who is curious what the CORRUPT FAGGOT MODS are up to and why 4chan has turned into low IQ mainstream bullshit for Reddit politicos now. It's because CORRUPT PIECES OF SHIT are curating discussion for political pov:

>a bunch of retarded faggots learn the theory that systemic emergences can lead to inequitable outcomes
>proceed to petulantly defend the system no matter what because it's the system that gives them privilege

Sorry for talking about you and hurting your feelings, you glowfaggot pile of shit with no respect for the rights of others who is bringing your glowfaggot autocratic shadowbanning from Reddit to 4chan now. You bootlicking, powertripping fly on a faggots turd. You literally state socialist literal Nazi.

>>	Anonymous Tue Mar 7 00:05:10 2023 No.53959782 >>53958682 Celebrate with a little bit of chicken fried

>>	Anonymous Tue Mar 7 00:06:05 2023 No.53959791 File: 906 KB, 720x720, doom_paul_1.png [View same] [iqdb] [saucenao] [google] I'm actually now slightly concerned all of you have gone funny in the head because of some astrology bullshit.

>>	Anonymous Tue Mar 7 00:06:45 2023 No.53959797 File: 44 KB, 220x225, 1674502404134286.gif [View same] [iqdb] [saucenao] [google] JPOW fucking my shit on wens?

>>	Anonymous Tue Mar 7 00:06:50 2023 No.53959798 >>53959772 KEK!!!

>>	Anonymous Tue Mar 7 00:07:04 2023 No.53959803 >>53959759 of what?

Anonymous Tue Mar 7 00:07:45 2023 No.53959808

>>53959732
These...
>>53958149

As for tech, I do have EBAY, but there's too much emotion and bulltards behind most of the other stupid tech stocks (that absolutely are ridiculously overvalued). Best to short stocks that are out in the periphery and in the shadows, away from the prying eyes of retarded FOMO bulls. That being said, when reddit tech bulls are finally shaken out of the market, I might go long TECS 3x leveraged inverse Tech ETF.

>>	Anonymous Tue Mar 7 00:08:35 2023 No.53959817 >>53959803 uh...BOIL?

>>	Anonymous Tue Mar 7 00:10:43 2023 No.53959832 File: 123 KB, 1000x1000, 1676219259963635.jpg [View same] [iqdb] [saucenao] [google] >>53959473 AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

>>	Anonymous Tue Mar 7 00:12:08 2023 No.53959845 File: 135 KB, 1200x676, 1671210111852191.jpg [View same] [iqdb] [saucenao] [google] >>53959797 Jerome speaks tomorrow

>>	Anonymous Tue Mar 7 00:12:15 2023 No.53959846 Execute gookmoot and the biz mod in the most violent and painful way possible, I hate these bastards so much

Anonymous Tue Mar 7 00:12:38 2023 No.53959850
File: 8 KB, 244x207, Science Apu.jpg [View same] [iqdb] [saucenao] [google]

>>53959791
If we consider /smg/ a homogeneous mixture of sane-ish normies and hardcore schizos, we can model a "boil off" scenario wherein market crashes followed by bullshit crab markets where nothing happens cause normies to leave. This kicks off a feedback loop of higher thread schizo content driving off more normies. Which all leaves /smg/ with a higher and higher proportion of schizos.

Which is to say this is a bottom signal. Long TQQQ.

>>	Anonymous Tue Mar 7 00:14:36 2023 No.53959867 File: 28 KB, 750x440, DE093E06-E3D0-4232-9F16-F14680B80123.jpg [View same] [iqdb] [saucenao] [google] 3 figure hell 3 figure hell boil boil boil My blood boils A baggie for life a baggie for like 3 FIGUEr hell

>>	Anonymous Tue Mar 7 00:14:58 2023 No.53959874 File: 244 KB, 752x575, Peter Lynch thinking.png [View same] [iqdb] [saucenao] [google] >>53959850 This is astoundingly plausible.

Anonymous Tue Mar 7 00:15:30 2023 No.53959880 [DELETED]

File: 138 KB, 720x1146, Screenshot_20230217-165353_Photos.jpg [View same] [iqdb] [saucenao] [google]

>>53959780
I like to post my softcore lewds to trigger the fatties and "hamchads" around here but the problem is the jannies seethe too and ban me for posting them. Gym gains are the only gains the jews can't steal from you.

Buy more BOIL

>>	Anonymous Tue Mar 7 00:16:39 2023 No.53959890 >>53959850 Hey mumu, how about you cut off the fancy speak and start grabbing ankles for JPow's massive "tools"? You like that, mumu??

Anonymous Tue Mar 7 00:20:10 2023 No.53959919
File: 28 KB, 383x383, Science Pepe at Meme State University.jpg [View same] [iqdb] [saucenao] [google]

>>53959890
Jerome Powell is bitchmade. Did you not notice him pussy out about financial conditions not once but twice the last couple pressers?

Most likely we rally on the removal of event risk. Outside chance we rally strongly when he begins talking about QE for climate change and reparations bonds.

>>	Anonymous Tue Mar 7 00:21:51 2023 No.53959940 File: 124 KB, 498x337, 1674776380699151.png [View same] [iqdb] [saucenao] [google] >>53959890 shoo Morgan Stanley analyst shoo

>>	Anonymous Tue Mar 7 00:23:28 2023 No.53959954 Are pair trades a meme?

>>	Anonymous Tue Mar 7 00:26:36 2023 No.53959981 >>53959954 Everything is a meme.

>>	Anonymous Tue Mar 7 00:27:37 2023 No.53959992 Reminder that oil just broke above 80, which means it's going to do another autistic dump back to the low 70s.

>>	Anonymous Tue Mar 7 00:30:20 2023 No.53960014 File: 267 KB, 1000x1500, IMG_4257-e1426266095441-1000x1500.jpg [View same] [iqdb] [saucenao] [google] >>53959992 Maybe. But rigs are bit down and demand is picking up now from Chyna. But Im not sure its going to hit $90 from here before coming down.

>>	Anonymous Tue Mar 7 00:30:20 2023 No.53960013 Execute gookmoot and his buttboy biz mod with fire

>>	Anonymous Tue Mar 7 00:30:27 2023 No.53960016 File: 1.36 MB, 640x358, 1629915911676.gif [View same] [iqdb] [saucenao] [google] >>53959850 I'm not a schizo. I'm a clairvoyant. Big fan of schizos tho.

>>	Anonymous Tue Mar 7 00:30:35 2023 No.53960018 >>53959954 Good luck identifying them. Pair trading isnt something done browsing through charts on WeBull, its done by the millisecond by Hedge Fund arbitrage-hunting algos.

>>	Anonymous Tue Mar 7 00:33:27 2023 No.53960040 File: 115 KB, 351x310, 1656655782379.png [View same] [iqdb] [saucenao] [google] Bros, my fever has gone down finally. Hopefully I can go to the market tomorrow I checked and today I made $300, which is nice I guess

Anonymous Tue Mar 7 00:34:18 2023 No.53960048
File: 1.18 MB, 1080x1324, 1669591411623715.jpg [View same] [iqdb] [saucenao] [google]

Hi niggers I'm back after my 2 week hiatus. Not trading has made me happy and soft, ended up failing an exam today. So from tomorrow, I'm going back in. So what's it gonna be tomorrow, 0dte calls or puts?

>>	Anonymous Tue Mar 7 00:36:43 2023 No.53960067 l-arginine zinc anything else i should take for god tier cooms? drinking lots of water too

>>	Anonymous Tue Mar 7 00:38:22 2023 No.53960077 >>53960067 I just shat a big ass log into my toilet bowl. mix of fards and shids felt wonderful

>>	Anonymous Tue Mar 7 00:39:07 2023 No.53960082 >>53960067 Pineapple, do kegals hip thrust glute splits uhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh I think blue balling and edging help but im not too sure : l

>>	Anonymous Tue Mar 7 00:39:08 2023 No.53960083 >>53960077 Based.

>>	Anonymous Tue Mar 7 00:39:11 2023 No.53960084 >>53960048 Both, its crab season.

>>	Anonymous Tue Mar 7 00:42:00 2023 No.53960107 >>53960098 >>53960098 >>53960098

>>	Anonymous Tue Mar 7 00:43:16 2023 No.53960117 early bakers is kill

>>	Anonymous Tue Mar 7 00:43:26 2023 No.53960118 File: 10 KB, 274x274, 1614870474685.jpg [View same] [iqdb] [saucenao] [google] >>53960107 TOO SOON REEEEE!!!!!

>>	Anonymous Tue Mar 7 00:44:48 2023 No.53960132 >>53960040 That's very nice, both that you are getting better, and that you made $300. My entire portfolio is $260.79. I made $1.49 during market hours, but down 70 cents in the after hours.

>>	Anonymous Tue Mar 7 00:46:11 2023 No.53960143 >>53959768 It's Washington DC. The other posts, idk, I waged today. It's not surprising that it's real, they're just seeing if you're new. You took the bait.

>>	Anonymous Tue Mar 7 00:47:09 2023 No.53960151 NEW >>53960142 >>53960142 >>53960142 >>53960142

>>	Anonymous Tue Mar 7 00:47:19 2023 No.53960154 >>53960107 They 404'd it, but I'd like to see the pic.

Anonymous Tue Mar 7 00:47:46 2023 No.53960161

>>53960018
Tons of alpha in random ass non-fundamental pure correlation pairs trades. Like stocks or baskets that are not even remotely related to each other. its pure alpha. and yes you're right, none of us on smg are gonna be able to do this lol. i know a signal processing nerd who does this shit, he makes me look like a SOXL tard

>>	Anonymous Tue Mar 7 00:48:19 2023 No.53960166 >>53960151 Also premature.

>>	Anonymous Tue Mar 7 00:48:31 2023 No.53960168 >>53960154 no, we can't post Jpow with boobies nooooo that would be terrible haha

>>	Anonymous Tue Mar 7 00:48:31 2023 No.53960169 File: 284 KB, 680x680, 1618672588117.png [View same] [iqdb] [saucenao] [google] >>53960151 HE DID IT AGAIN!!!! REEEEEEE!!!!

>>	Anonymous Tue Mar 7 00:51:29 2023 No.53960193 Baking.

>>	Anonymous Tue Mar 7 00:53:49 2023 No.53960211 TOO MANY BAKINGS TOO MANY BAKINGS AAAAAAAAAAAAAAAAAAA

Anonymous Tue Mar 7 00:54:20 2023 No.53960215

So Toyota
>doesn't comply with the left for jumping the gun on EV motors like the rest of the car manufacturers, so they can study the new technology further
>gets attacked by the left for not doing so
>even though they are still having good years in sales and still one of the best car manufacturers in the world (if not the best) with good reliability and handling their stock price tanks
>CEO steps down to become chairman
What are the odds that big wallstreet are the reason their price is tanking because they aren't aligning themselves with woke issues (ESG type shit) even though they are still having amazing sales? Do you think their stocks will raise back up with the new CEO?

>>	Anonymous Tue Mar 7 00:55:44 2023 No.53960230 holy shit so many deleted posts in this thread. is scoopsies posting loli cunny again?

>>	Anonymous Tue Mar 7 00:56:36 2023 No.53960240 >>53960215 I thought they were leaning into Hydrogen because the Jap government was into it in a big way.

Anonymous Tue Mar 7 00:57:41 2023 No.53960251

>>53960215
Doesn't Toyota have a hybrid? IMO that is by far the most sensible next step for quite some while. I know someone that has a hybrid, which I think is a Toyota, and it gets excellent gas mileage, the engine keeps the EV part charged, and it has lasted 400,000 miles so far and no major surgery required.

>>	Anonymous Tue Mar 7 00:58:43 2023 No.53960259 >>53960215 Theyre one of the few companies with a functioning hydrogen vehicle(mirai). They need a hybrid taco, that shit would sell gangbusters I tells ya.

>>	Anonymous Tue Mar 7 01:02:11 2023 No.53960281 >>53960215 ESG is a cancer on the world, our only hope is that bullshit dies after a giant crash

>>	Anonymous Tue Mar 7 01:03:26 2023 No.53960294 >>53960215 Their stock dumped with just about everyone else as inflation story line kicked in. But I think they or another big asian admitted the 100% ev by 2030 isnt possible.

>>	Anonymous Tue Mar 7 01:05:00 2023 No.53960311 Glowniggers hate it when you discuss their subversion campaign on 4chan. How do I profit from this?

Anonymous Tue Mar 7 01:06:14 2023 No.53960322

>>53960240
I think they were experimenting with alternative solutions because EV isn't fully tested and the former CEO stated that he thinks EV is untested technology that could end up being worse in the long run. And for what it's worth I think that's safe to say, considering Tesla has had an insane amount of issues over the years.

>>53960251
>>53960259
They have a shitton of hybrids and yeah they are some of the best cars in the world. Pretty sure the Prius was the first ever hybrid even. But they are getting their ass slammed by woketards. There have been protests, social media raids, there is a "company" called Public Citizen that has been going around to Toyota events crashing them, they spam call their phone lines thousands of times, etc. And the company has received the lowest score in the environmental awareness or whatever category 2 years now.
https://www.youtube.com/watch?v=tpXwCYtIOIM
This video goes over a lot of it and it's made me really think, considering there are plenty of stocks and even crypto in recent years which seem like the price isn't actually being moved by the people but is being manipulated by big market makers on wall street. It feels like they are being targeted to try and "cancel" them until they go full EV.

>>	Anonymous Tue Mar 7 01:07:42 2023 No.53960343 >>53960311 become a glowie so you can get paid for inane posts instead of doing them for free?

>>	Anonymous Tue Mar 7 01:13:42 2023 No.53960377 File: 73 KB, 576x328, 1672962376154416.png [View same] [iqdb] [saucenao] [google] We're apparently all a little mad here.

>>	Anonymous Tue Mar 7 01:13:52 2023 No.53960379 >>53960322 >They have a shitton of hybrids No one makes a hybrid truck yet, or ev for that matter but ev trucks are fucking stupid.

>>	Anonymous Tue Mar 7 01:15:20 2023 No.53960393 >>53960379 At least Toyota stands toe to toe with Ford with their trucks. There was a dude who drove his Toyota for over 1 million miles and broke a record, so they gave him a new 2016 model for free.

>>	Anonymous Tue Mar 7 01:22:33 2023 No.53960446 >>53959040 why are you investing in a leveraged etf?

>>	Anonymous Tue Mar 7 01:24:57 2023 No.53960470 >>53960322 That was a pretty fascinating video, I didn't know much of that at all. I wouldn't have an all EV other than as a gift that I could sell.

>>	Anonymous Tue Mar 7 01:25:27 2023 No.53960476 File: 19 KB, 399x225, 1648827619484.jpg [View same] [iqdb] [saucenao] [google] OP fucked up the links >GG not baking til 380

>>	Anonymous Tue Mar 7 01:26:50 2023 No.53960490 >>53960470 I do hope their price rises now though, down 12% in 5 years, if they go back up would be a great price to get in at.

>>	Anonymous Tue Mar 7 01:28:06 2023 No.53960506 >>53960470 >>53960490 1 year* And yeah Scotty is great

>>	Anonymous Tue Mar 7 01:28:14 2023 No.53960508 >>53960490 Maybe it will moon on the first news of an EV running out of charge in Compton.

>>	Anonymous Tue Mar 7 01:29:49 2023 No.53960522 File: 116 KB, 1280x720, borat.jpg [View same] [iqdb] [saucenao] [google] Baking NOT.

>>	Anonymous Tue Mar 7 01:37:32 2023 No.53960587 Last SMG thread

>>	Anonymous Tue Mar 7 01:39:46 2023 No.53960604 File: 162 KB, 960x870, How do skeletons have hair.jpg [View same] [iqdb] [saucenao] [google] Dead market Dead posters Dead thread

>>	Anonymous Tue Mar 7 01:45:43 2023 No.53960667 >>53959593 tummies

>>	Anonymous Tue Mar 7 01:46:10 2023 No.53960671 File: 82 KB, 300x252, 1675746117950647.png [View same] [iqdb] [saucenao] [google] >>53960604 Man, remember Goosebumps? Do kids even read anymore?

>>	Anonymous Tue Mar 7 01:46:49 2023 No.53960678 >>53960671 https://www.youtube.com/watch?v=RySHDUU2juM

>>	Anonymous Tue Mar 7 01:48:35 2023 No.53960696 >>53960671 I am hoping the whole diary of a wimpy kid stuff has finally been flushed at long last at least.

>>	Anonymous Tue Mar 7 01:48:58 2023 No.53960702 File: 96 KB, 750x719, 1677037207510125.jpg [View same] [iqdb] [saucenao] [google] I've never had sex.

>>	Anonymous Tue Mar 7 01:50:21 2023 No.53960711 File: 43 KB, 750x539, 23 and nothing.jpg [View same] [iqdb] [saucenao] [google] >>53960702 IT HURTS THIS IMAGE HURTS HBGEACASUR IMA A zOOORMERN VagdsafnhjafhbjkaeSDGFHJVAWEYJU FGKHdewhybgfjbhvzsdfghbjvadsfjvghabvghjdsfvhjaer

>>	Anonymous Tue Mar 7 01:51:14 2023 No.53960719 U KNOW THE DRILL >>53960712 >>53960712 >>53960712 >>53960712

Advanced search
Text to find
Subject [?]Search by post subject. Leave empty for any.
Username [?]Search for user name. Leave empty for any user name.
Tripcode [?]Search for tripcode. Leave empty for any.
Email [?]Search by email. Leave empty for any.
Filename [?]Search by image filename. Leave empty for any.
From Date [?]Enter what date to start searching from. Format is YYYY-MM-DD
To Date [?]Enter what date to start searching until. Format is YYYY-MM-DD
Image hash
Search in	All Posts OPs Only
Deleted posts	Show all posts Show only deleted posts Only show non-deleted posts
Internal posts	Show all posts Show only internal posts Show only archived posts
Order	New posts first Old posts first
Capcode	All Posts Only by Users Only by Mods Only by Admins Only by Developers
Results	Posts Threads
Action	[ Simple ]

/biz/ - Business & Finance