[ 3 / biz / cgl / ck / diy / fa / ic / jp / lit / sci / vr / vt ] [ index / top / reports ] [ become a patron ] [ status ]

/biz/ - Business & Finance


View post   

File: 2.01 MB, 640x640, 1677530520629380.webm [View same] [iqdb] [saucenao] [google]
53957857 No.53957857 [Reply] [Original]

You can't hear it. You can't feel it, but you get heemed by it. You trades lose because of it. You know it's there. Always with you fucking up your gains.

There HERE!!!!!!!!!

Shizcoucational sites:
https://www.investopedia.com/
https://www.khanacademy.org/economics-finance-domain

>Shizcoancial TV Streams:
https://watchnewslive.tv/watch-cnbc-live-stream-free-24-7/
http://www.livenewson.com/american/bloomberg-television-business.html
https://watchnewslive.tv/watch-fox-business-network-fbn-free-24-7/

>Shizcoyarts:
https://www.tradingview.com
https://www.finscreener.com
https://www.koyfin.com/
https://www.portfoliovisualizer.com

>Shizcoeeners:
https://finviz.com/
https://www.tradingview.com/screener
https://etfdb.com/

>Shizcotions
https://www.optionsplaybook.com/options-introduction/
https://www.optionsprofitcalculator.com
https://optionstrat.com/
https://www.optionistics.com/quotes/option-prices

>Shizco-Market and Live data:
https://www.investing.com/indices/indices-futures
https://finance.yahoo.com/

>Shizcoendars
https://www.marketwatch.com/economy-politics/calendar
https://www.earningswhispers.com/calendar
https://www.cmegroup.com/trading/interest-rates/countdown-to-fomc.html

>Shizcomer Investing 101:
https://www.bogleheads.org/wiki/Getting_started

>Misc:
https://tradingeconomics.com/
https://finance.yahoo.com/trending-tickers
https://market24hclock.com/
https://wallmine.com/
https://fintel.io/
https://www.dividendchannel.com/drip-returns-calculator
https://brokerchooser.com/
https://www.chathamfinancial.com/technology/us-market-rates

Previous >>53956962

>> No.53957869

this land is cursed

>> No.53957877

Please keep your mental illness to a minimum in this thread, thank you.

>> No.53957882
File: 220 KB, 1587x904, 13259539189000.jpg [View same] [iqdb] [saucenao] [google]
53957882

>>53957857
>Shizcho

>> No.53957883

I'm embarrassed to even report how my portfolio performed today.

>> No.53957889

How do I become a onions boy?

>> No.53957895

>>53957883
If you can't face your losses, your wins won't be as sweet.

Also that's a very easy way to end up bagholding.

>> No.53957894
File: 2.99 MB, 720x404, 1674084311681591.gif [View same] [iqdb] [saucenao] [google]
53957894

fucking hate this market.

>> No.53957898
File: 2.46 MB, 1469x1054, golden_brown.png [View same] [iqdb] [saucenao] [google]
53957898

Nobody knows which poster from the previous thread I am

>> No.53957906
File: 25 KB, 703x360, 1638828268486.jpg [View same] [iqdb] [saucenao] [google]
53957906

>>53957898
I know you're the schizo racist Indian.

>> No.53957911
File: 55 KB, 552x769, 1678134932630552.jpg [View same] [iqdb] [saucenao] [google]
53957911

>>53957882
It's the korean version of Schizo

>> No.53957919
File: 184 KB, 2850x328, Screenshot 2023-03-06 at 1.13.11 PM.png [View same] [iqdb] [saucenao] [google]
53957919

>>53957670
My white school shooter friend, if you want to know why Indian-Americans are far more successful / wealthy than Whites in the USA, its because we're smart enough to short shitty uranium miners like DNN. Pic related lol. Wondering what kind of uranium bags you're holding to make you seethe this much about the fact that my capital gains taxes on shorting uranium names are going to pay for your cousin's opiate overdose in Kentucky

>> No.53957925

>>53957889
listen if you become a soiboi you might have ONE average brown girl mildly interested in you, but if YOU become the bpd art-type one then you will have DOZENS of average brown girls VERY interested in you

>> No.53957927
File: 736 KB, 758x658, Go on a diet, ya fat bitch.png [View same] [iqdb] [saucenao] [google]
53957927

>Entire threads covering fast food only indicates America's growing obesity problem
All the more reason to be long on KO, MCD, and YUM

>> No.53957940

>>53957927
Don't forget to long GO.Grocery Outlet sells super cheap dogshit that EBT goy cattle eat. Great deals at GO though.

>> No.53957939
File: 253 KB, 220x220, 1677985652459486.gif [View same] [iqdb] [saucenao] [google]
53957939

>>53957906
I haven't been offended this badly in a long time

>> No.53957941

>having even the foggiest fucking clue how anything works beyond what CNBC is spoonfeeding to redditors' assholes is "schizo propaganda"

>> No.53957951

>>53957889
Watch sissy hypno and drink Onions for every meal, also become a femminist.

>> No.53957953
File: 68 KB, 720x540, 1675276765557923.jpg [View same] [iqdb] [saucenao] [google]
53957953

Good threads today guys

>> No.53957956

>>53957941
cool it down on the extremism anon, how dare you state that modern society is flawed and discouraging

>> No.53957967

A CHINESE CIA JOE BIDEN MARKET SETPOINT JUST MOLESTED MY PENIS OVER MY HOUSE

>> No.53957969

>>53957953
/biz/ is dead - always has been

>> No.53957973

Hey, the market did not dip much today, but it also did not go up much today.
Do not go to the stock market tomorrow

>> No.53957985

>>53957967
WHAT DO YOU MEAN BY THIS ANON?
WHAT IS A MARKET SETPOINT?
DO YOU MEAN HOW IN CHINA ALL THE GLOWIES GET TOGETHER AND DECIDE WHAT THE PRICE OF VARIOUS STOCKS SHOULD BE?

PLEASE EXPLAIN!

>> No.53957988
File: 168 KB, 1008x1038, Hello.jpg [View same] [iqdb] [saucenao] [google]
53957988

This is a good investment, financially speaking.

Also - I hate being right, but too early. How to cope?

>> No.53957989

>>53957927
MCD has just kept going up and up despite the death of the value menu being actual good deals and all their regular prices mooning to what used to get you actual good meals from actual real restaurants.

>> No.53957993
File: 39 KB, 656x679, b0e.jpg [View same] [iqdb] [saucenao] [google]
53957993

I lost a small amount of money today

>> No.53957997

>>53957857
>blackmanfightssystemicracism.webm

>> No.53958002

>>53957988
get the air, the pro is a meme these days

>> No.53958006

Good time to buy Intel now. They completed specifications on their new nodes and are releasing in 2024 ahead of schedule. And I think all the bad news is out of the way so it's only going to go up from here.

https://www.tomshardware.com/news/intel-completes-development-of-18a-20a-nodes

>> No.53958010

>>53958006
Massive short signal for INTC here

>> No.53958016

>>53957898
you're the anon that wants rocker's life ruined and was too much of a pussy to short NSC

>> No.53958022
File: 359 KB, 1024x1024, 1674135338631667.jpg [View same] [iqdb] [saucenao] [google]
53958022

>>53957967
That reminds me, I saw a guy in a Beijing Biden t-shirt at the hardware store over the weekend. He looked like a textbook chud meme. I bet the non-binary, painted fingernail having genderfluid cashier was internally seething during the entire transaction.

>> No.53958025
File: 138 KB, 553x466, 1610467762227.png [View same] [iqdb] [saucenao] [google]
53958025

I gained a small amount of money today

>> No.53958030

>>53957919
We heard you the first time.

>> No.53958032
File: 1.79 MB, 197x213, 1669836086382095.gif [View same] [iqdb] [saucenao] [google]
53958032

What the fuck have you guys been posting about? Chicken wings? Chicken feet? Chicken penis? $2 pizzas? Haven't you forgotten that I'm speaking soon? Not a single person posted any meme with me and I feel offended. I will teach you the pain.
Powell out

>> No.53958033

>>53958025
Congrats nigger bear

>> No.53958038

>>53958032
WHOAH BLACK BETTY

>> No.53958045

>>53958032
you make less than a mcdonald's manager nigga, shut the fuck up

>> No.53958048

>>53958002
Hm yes, that is true - even though they scam you for the RAM cost, it still works out half the price for the M2 version.

>>53958025
By doing what?

>> No.53958051

I will never recover from my $52 TQQQ average

>> No.53958052

>>53958025
>>53957993
boring equities market. KOLD KANGS EATING GOOD TONIGHT!

>> No.53958053

>>53958032
That was 2 threads ago

>> No.53958056

>>53957857
so is xtrx adastara going to be selling cocaine to distributors in canada or not!? I want to get in while it's under a dollar but if they aren't going to distribute cocaine they aren't going to have any liquidity and float! I'M CONFLICTED!

>> No.53958080

>waaaahhh there are black people
>better waste my life trying to make enough money so me and mrs roastie can have an IVF baby at 45

>> No.53958085
File: 420 KB, 600x830, 120.png [View same] [iqdb] [saucenao] [google]
53958085

Rocker-sama...
TRKA shill-kun...
I kneel.

>> No.53958086

>>53958080
AI post or schizo post?

>> No.53958091

>>53957919
Who knew running immigration mills masquerading as shitty disgusting nigger magnet corner stores could be so profitable. Your counterparty risk is a whole country full of Indians not being shitty enough to want to flee at all costs so I guess it's a pretty safe investment;^}

>> No.53958106

>>53958086
Maybe it's both.

>> No.53958107

>>53958053
Previous thread is hard to describe. I think it could be used as a training myterial for detecting early onset of schizophrenia in demented patients.

>> No.53958112

>>53957919
yeah but whats the point of being rich when no women are attracted to you

>> No.53958113

>>53958086
>>53958106
>implying there's something organic about intelligence in the first place

>> No.53958118

>>53958080
45 year old man don’t need no IVF. Just a 25 year old wife.

>> No.53958122

>>53958006

If they're still staffed by 90% jeets then lolno. The east asian competition will continue crushing them via 20 IQ point spread. Get back to me when Chyna really goes for Taiwan for realsies.

>>53958032

Personally I was posting about soup dumplings. It is entirely too hard to find the damn things in the US, and I would all-in on any startup that was gearing up to sell them fast-food style. I'm convinced they'd take off, if only people knew how delicious they are.

https://www.youtube.com/watch?v=5962719UC0s

>> No.53958123

>>53958118
well of course i agree with you, but
>current year

>> No.53958129

>>53958107
Idk I thought it was nice

>> No.53958136

>>53958122
When is burgerland going to poach the bugmen from Taiwan to get their own semi conductor operations going?

>> No.53958140

>>53958112
That’s why God made created Bosnia. Pack your bags and go get a wife.

>> No.53958149

>>53957857
Shill me on why I'm retarded....

Long
MRK

Short
EBAY
WU
HAS
LULU
UEC

>> No.53958152

Thread Theme:
https://www.youtube.com/watch?v=Dkk9gvTmCXY

>> No.53958155

>>53958051
Come back in 10 years

>> No.53958156

>>53958136
could the nips be persuaded to take them in?
japan needs to be a tech powerhouse again

>> No.53958159

>>53958051
Yikes bro. Just dca! I trade a lot of that shit too. Just put a stop in 10% under the price and bump it up every day. I was sad when my sqqq tapped the stop at 38 and shot up to 41, but now I'm glad it happened. Bump till stop gets tapped then reverse, only way to do 3x

>> No.53958166

>>53958129
I liked it too. Reminded me of shittalk from 2021 bullrun era. The magical part is almost nothing was said despite us producing 300 posts. It's like magic.

>>53958122
Can't help you with that mate. You can always buy some t-bills if you want to support my startup tho.

>> No.53958168

>>53958152
untalented giraffe looking bitch
the fucking TJ Maxx of music

>> No.53958174

>>53958136
you mean we need to start colonies of bugs in Arizona, Texas, Ohio? Is that why Ohio got gassed?

>> No.53958178
File: 2.03 MB, 1047x1360, 1678009251261845.png [View same] [iqdb] [saucenao] [google]
53958178

>>53957894
Me too. Very hard to trade. My female broker has been pouting all year.

>> No.53958179

>>53958149
You are retarded because you are short ebay and i love ebay

>> No.53958189

>>53958136
>doesn’t know about SKYT

Way ahead of you, ranjesh

>> No.53958192

>>53958168
Sounds a bit misogynistic honey.

https://www.youtube.com/watch?v=NeQM1c-XCDc

>> No.53958196

>>53958179
fuck ebay
MCARY
MCARY
MCARY

>> No.53958197

>>53958189
My name is Craig.

>> No.53958205

>>53958197
do you pronounce that 'cregg' or the right way?

>> No.53958206
File: 137 KB, 707x1000, 1674743617100081.jpg [View same] [iqdb] [saucenao] [google]
53958206

>>53958178
Same.

>> No.53958207

>>53958179
Not an argument

>> No.53958211

>>53958168
Someone had to tell the voices in my head what to do.
https://www.youtube.com/watch?v=W1PNvopXjbg

>> No.53958215
File: 838 KB, 648x728, file.png [View same] [iqdb] [saucenao] [google]
53958215

inflation is over

>> No.53958224

>>53958196
NEVERRRRRRRRRRRRRRRRRRRRRRRR MCARY
REEEEEEEEEEEEEEEEEEEEEEE

>> No.53958225

>>53958205
The correct way, only in America do they pronounce it like that. I don't know why.

>> No.53958226

Bearbros, why is SPY going up? Doesn't SPY-sama know JPow-sana is speaking tomrrow desu senpai baka?

>> No.53958228

>>53957919
Lol, big seethe from the poo. I’m not invested in uranium, by the way. That would be dumb considering pellet reactors use recycled fissile material. I’m mad bullish on power companies though. Their overhead is going to get completely subsidized by the government.

>> No.53958229
File: 350 KB, 220x264, Jefferson.gif [View same] [iqdb] [saucenao] [google]
53958229

>>53958215

>> No.53958231

>>53958215
SHUT THE FUCK UP ANON NOW EVERYONE IS GONNA KNOW

>> No.53958233

>>53958225
they also think 'Graham' is 'gram'
fucking retards, and i have to live among them

>> No.53958236

>>53958156

Actually this is much more likely than the US doing it via the CHIPS act like we are trying now. We are not capable of building a semi fab workforce that is exclusively 130+ IQ, Japan is. And China might get Taiwan, but never Japan.

To be clear: the talent exists within the US, but nepotism and woke political bullshit will prevent any real meritocracy. So Japan is a likely replacement for Taiwan once our bungling attempts are reproducing TSMC inevitably fail, because it turns out pedro and shaneequa can't design chips or run lithography machines worth a god-damn.

>> No.53958241
File: 12 KB, 306x436, secret_candles.jpg [View same] [iqdb] [saucenao] [google]
53958241

>>53957857
how are you supposed to trade this?
how is this legal?

>> No.53958243

>>53958197
Whoops, sorry. Go on about your business. I found the turd-man I was looking for anyway.

>> No.53958255

>>53958215
I want to fertilize those eggs iykwim

>> No.53958256

>>53958211
Based.
https://www.youtube.com/watch?v=KDHd-vxcMDo

>> No.53958258

>>53958233
How else would you say it

>> No.53958260
File: 459 KB, 1656x1242, Fqi89TAXwAM8-0d.jpg [View same] [iqdb] [saucenao] [google]
53958260

>>53957857

>> No.53958261
File: 109 KB, 1121x596, Eggs.jpg [View same] [iqdb] [saucenao] [google]
53958261

>>53958215
Why can't Americans into eggs? They look like they have zero nutritional value.

https://www.clarencecourt.co.uk/our-eggs/egg-range/

>> No.53958265
File: 194 KB, 627x573, english.png [View same] [iqdb] [saucenao] [google]
53958265

>>53958258
"gramme"

>> No.53958269

>>53958241
If you wanted a real market maybe your great grandpa shouldn't have stopped that Austrain artist with the funny mustache

>> No.53958271
File: 90 KB, 1170x1048, B8330502-A90D-477B-B06A-31ADBB72999A.jpg [View same] [iqdb] [saucenao] [google]
53958271

>>53958107
Damn I missed it

>> No.53958273
File: 551 KB, 664x923, pogkpdfkg.png [View same] [iqdb] [saucenao] [google]
53958273

>>53958258
'grey em'

>> No.53958274
File: 439 KB, 648x826, Screen Shot 2023-03-06 at 2.41.12 PM.png [View same] [iqdb] [saucenao] [google]
53958274

>>53958261
Costco offers brown eggs for a higher price.
>>53958241
Be part of the club, obviously.

>> No.53958275
File: 23 KB, 500x353, 1676074191812994.jpg [View same] [iqdb] [saucenao] [google]
53958275

Does anyone have source to that manga where the female broker acts all tsundere and stuff? I am feeling a bit broken today and need something cushy

>> No.53958282
File: 181 KB, 858x823, 1678135791906468.jpg [View same] [iqdb] [saucenao] [google]
53958282

>>53958226
Don't know why in particular. I don't deal in why though. I just do what line says. Today chart shifted from likely bear market rally to iffy crabby not sure and therefore i had to abandon my conservative position of 100% sqqq for a measly 3% profit.
pic related my female broker's intern

>> No.53958285
File: 395 KB, 755x460, penguin eggs.png [View same] [iqdb] [saucenao] [google]
53958285

>>53958261
you could sell these bad boys for major cash

>> No.53958287

>>53957989
People keep buying Mcd even though it's not even cheap anymore, it was never about the prices

>> No.53958289

Market red tomorrow, not financial advice

>> No.53958290

>>53958215
This is literally my 16year old niece

>> No.53958306

DOLE earnings tomorrow premarket banana bros.

>> No.53958309

>>53958207
yeah sorry my man I dont have any real advice on those tickers I havent been studying those ones, but given the general environment I can understand being short HAS and LULU

>> No.53958319

>>53958306
looks like someone got it early

>> No.53958321

Today BOIL got hit with some light profit taking. Just some minor retracing is all but tomorrow we will be right back on track to higher highs this week :)

>> No.53958327

>>53958282
She looks like a slut

>> No.53958332
File: 245 KB, 1484x762, FqkLFyyXsAgODI4.jpg [View same] [iqdb] [saucenao] [google]
53958332

>>53957857
https://www.foxbusiness.com/technology/amazon-go-stores-close-cities-coast-coast

https://www.businessinsider.com/amazon-go-stores-closing-nyc-san-francisco-seattle-2023-3

I thought it was weird how AMZN was dumping today but I can see it dropping even more for the rest of this week and maybe this month. I have a feeling that Bezos pulled the plug behind the scenes and now we are seeing the whole company slowly spiral down. How does a corporation that big come out so shit after their golden age during the pandemic?

>> No.53958335

>>53957989
yeah i used to look at a mcd's meal and say 'fuck that, could go to a sit down for that' and then i actually went to a sit down in 2022 lol

>> No.53958336

>>53958327
in training

>> No.53958337

if you're not daytrading nasdaq futures you're probably gaytrading homo shit
dork

>> No.53958340

>>53958215
aaaaaaaaaannnddd the eggs are all sold out.

>> No.53958341

>>53957919
Quite a surprise to find out that CRBPajeet has any profitable trades to show. Between your SAVA shorts, the nonsense volga spam, and the time you thought it was a good idea to go long SIGA spreads 6 months out into December at the peak of that pump, I just assumed your performance is irredeemable.
Congratulations.

>> No.53958356

>>53958261
i prefer great value eggs made from chickens that have never seen the light of day crammed into an area with over 9000 chickens per sq/m

animal products should be illegal

>> No.53958359

>>53958332
Why is it going down at all considering it's the biggest online store there is. What other online store is out there that can provide such competition that can even do that to amazon? Is it just the result of looming inflation/recession that's doing it?

>> No.53958363

>>53958335
I almost got a heart attack when I went to McDonalds (UK) and a double cheesburger and six nuggets cost £5.88 = $7.05, like what the fuck.

>> No.53958364

>>53958332
Sucks because I actually use Amazon, I couldn't give less of a shit about the other tech companies since I don't use Facebook or watch Netflix or have Windows etc

>> No.53958370
File: 2.34 MB, 576x1024, Day in the Life - Weeb.webm [View same] [iqdb] [saucenao] [google]
53958370

>>53958332
>How does a corporation that big come out so shit after their golden age during the pandemic?
Mediocre tangible products made in China, abysmal customer service, and terrible original Prime Video offers (other than ZeroZeroZero).
Still a decent bookstore if you can't find a discount brick & mortar option near your place. Most listed used books are in great quality.

>> No.53958379
File: 100 KB, 1128x655, Eggy.jpg [View same] [iqdb] [saucenao] [google]
53958379

>>53958285
A man of very discerning taste. How about an Ostrich egg as well?

>> No.53958382
File: 776 KB, 1080x1960, Screenshot_20230306-215036.png [View same] [iqdb] [saucenao] [google]
53958382

I thought smg rated this fuck. He's already turning bullish after being ultra bearish for months.
https://www.zerohedge.com/markets/michael-wilson-turns-tactically-bullish-sees-sp-rising-4150

>> No.53958383

>>53958356
This is actually the very reason I raise my own chickens, the only way to be sure the eggs came from a good place and the chickens had a good chicken life is to take matters into your own hands and do it yourself (or stop eating eggs which i will not do)

>> No.53958386

>>53958337
rude

>> No.53958411

>>53958386
DAYTRADE NASDAQ FUTURES
NOOOOOOOOW

>> No.53958414

>>53958370
Yeah Prime Video is terrible now - all the licences expired on the shit I watch, xfiles, star trek, loads of movies. Then they have that retarded LoTR show.

I dunno, I still use Amazon for all my online orders. I find their delivery to be very good. But it is flooded with tons of chink shit, and it's not a very good website to "browse" for things, you need to know what you want. They also wasted loads of money on pointless crap like alexa.

>> No.53958415

>>53958206
damn wish I had a cute coworker with thick legs at the office. Maybe even be top heavy too and I'd love my job everyday.

>> No.53958422

>>53958359
Could be decentralizing, ordering shit directly from somewhere and cutting out the middle man with Fed Ex and UPS

>> No.53958425

>>53958335

The fast food to watch is Sonic. Where else can you get chili cheese tater tots, soft pretzel and cheese dip, all-day sausage/egg/cheese croissant, popcorn chicken, and a cherry limeade to drink all in the same place, and have the food brought over to your parked car by a cute white girl? Exactly: no where else.

Unfortunately: https://en.wikipedia.org/wiki/Inspire_Brands
these guys don't seem to be public. Damn shame.

>> No.53958426

>>53958411
I don't have the money to buy even one futures contract on margin.

>> No.53958431

>>53958379
how devilishly delectable

>> No.53958437

life is a blast when you know what you're doing
best to know what you're doing 'fore your life get ruined
>https://www.youtube.com/watch?v=vG5La6k6eTI

>> No.53958447

>>53958426
THAT'S AWFUL MAN
YOU GOTTA CHANGE THAT

>> No.53958454

>>53958425
their food is garbage, except i do like that garlic butter burger they do seasonally
they do have some cute white girls tho

>> No.53958456

>>53958359
IIRC Walmart is actually beating AMZN in online sales. I couldn't believe it either, but they are. If you notice, AMZN doesn't do 'free 2 day shipping' with Prime anymore(doesn't even show up in checkout) and their shipping has been getting worse since 2022(literally took a month to ship a pair of shoes).

That and I noticed almost everything is more expensive now too. Why would I pay $40 for 180 count fish oil bottle when I could go to Walmart and get the same brand for 50% cheaper?

>> No.53958457

>>53958382
>at least for the near term - and writes that "equity markets survived a crucial test of support last week that suggests this bear market rally is not ready to end just yet" and concluding that "we could see further upside if the US dollar and interest rates continue their fall from Friday with next resistance for the S&P 500 at 4150 under such conditions."
>markets "reacted strongly from those levels, which suggests this will not be a one day wonder and the bear market rally is not yet over." Here is a snapshot of Wilson's technical observations"
>First, while our comments will focus on the S&P 500, these observations apply to most of the other major indices as well--i.e., the Nasdaq, Russell 2000 and the Dow Industrials, which remains the weakest of the bunch, in our view. First, in Exhibit 1 one can see that the key support was tested severely over the past few weeks but on Friday, the market reacted strongly around the second test. We have to respect that successful test and now need to try and decide what it means.
>this rally may still be on borrowed time despite the impressive price action on Friday.
>We showed this trendline in prior notes and continue to think it is critical that the S&P 500 get back above it to confirm a new bull market. As shown in Exhibit 2, this trendline has provided critical resistance and support over the past 14 years during this secular bull market. More recently, it has been more of a resistance line and that level comes in today at around 4150. While we think the S&P 500 could make another attempt at this key resistance, it will require 2 things in particular to surmount it--lower 10-year US Treasury yields and a weaker dollar. In fact, we think Friday's sharp fall in 10-year yields was an important driver of Friday's bounce in stocks. The dollar, too, showed some signs of exhaustion and it would be helpful if it can decline more meaningfully.
He hasn't turned bullish, he just thinks that we will test 4150 again

>> No.53958469

>>53958456
>and their shipping has been getting worse since 2022
This undeniable though, I don't even bother with prime anymore

>> No.53958471

>>53958356
Their all white, with all their frens, no rain, no cold, free food. We all should be so lucky.

>> No.53958476

>>53958382
>>53958457
he just thinks that we will test 4150 again, if yields continue to fall and dollar continues to fall
that we'll test this longterm post GFC trendline to the upside again, in a bear market rally
>our view remains the same-the bear market is not over--but we acknowledge that Friday's price action may extend it a few more weeks. Time will tell.
he just thinks the bear market rally will go on for some more time before fizzling
and I agree - if yields fall, dollar falls, the bear market rally will continue

>> No.53958477
File: 24 KB, 390x553, 5648971.jpg [View same] [iqdb] [saucenao] [google]
53958477

MARKET GO UP 0DTE PUTS AT HALFTIME
MARKET GO DOWN 0DTE CALLS AT HALFTIME
CLOSE POSITION 45 MINUTES BEFORE CLOSE

ITS A REAL LIFE MONEY GLITCH

>> No.53958479

>>53958456
>AMZN doesn't do 'free 2 day shipping' with Prime anymore
Wut? In the UK prime = free next day delivery on most items.

>> No.53958490

>>53958456
>Why would I pay $40 for 180 count fish oil bottle when I could go to Walmart and get the same brand for 50% cheaper?

And you can get it the same day too. I hate waiting for shit in the mail.

>> No.53958515

>>53958370
It would be really funny if they did dial back down to being a bookstore again when their debt gets way too big to pay off.

>> No.53958517

>>53958477
Die.

>> No.53958534

>>53958335
I don't go to any of them anymore unless I get a really good coupon. I stockpile pintos, corn (together they form a complete protein), brown rice, canned collards (KR brand is the only one with no added ingredients, otherwise I do all Great Value), peanut butter, etc.

>> No.53958535

>>53958479
The UK is also the size of Michigan

>> No.53958537

>>53958479
Really? In the USA, its impossible to get that option here which sucks. I used to use Prime shipping to get physical copies of video games on release, but not anymore.

>> No.53958552
File: 29 KB, 393x350, 1664479791229048.jpg [View same] [iqdb] [saucenao] [google]
53958552

>>53958454

Garbage is a little harsh, but yes everything they do somebody else does better, except maybe the drink variety.

The appeal is just the sheer variety. For some reason bouncing around between 5 different menu items makes them all taste better. It's like the cheerleader effect cept for food, idfk how to explain it.

>> No.53958563
File: 96 KB, 1024x944, 1652465598187.jpg [View same] [iqdb] [saucenao] [google]
53958563

I shan't listen to the Morgan Stanley exec.
>>53958515
Depends if people want to buy all the leftist-edited nu-versions of classics.
>Augustus Gloop is no longer considered "fat" in Charlie and the Chocolate Factory

>> No.53958570

I was going to sell covered calls today but forgot

>> No.53958579

>>53958535
Aye, I'm just saying.

Still I would have thought it would be better than 2+ days, unless you live in the middle of nowhere.

>> No.53958608
File: 409 KB, 1860x1600, -arZHc3gu.jpg [View same] [iqdb] [saucenao] [google]
53958608

Speaking of AMZN
>Amazon, $AMZN, is letting employees use their stock to finance home purchases and even second homes, per TechCrunch
>Now, Amazon employees have the option to help improve their chances of getting a loan for buying their house. Instead of coming up with the typical down payment, employees can use their vested equity as collateral to get a downpayment for their home purchase.

Amazon is allowing this in order to have complete control over their employees. Not productive enough and stock goes down? Well, you now owe thousands more on your mortgage. Its pretty fucked and will create more housing bubbles because the huge drop in AMZN share price is already causing decreases in worker salaries right now.

>> No.53958623
File: 102 KB, 900x642, Divvies are irrelevant.jpg [View same] [iqdb] [saucenao] [google]
53958623

Threadly reminder that dividends are irrelevant. If you want a bit of cash from your stocks, you can sell some.

>> No.53958639
File: 1.73 MB, 1169x1680, 1660078740055618.png [View same] [iqdb] [saucenao] [google]
53958639

I still get free 2-day shipping on nearly everything from Amazon, and in some cases next day shipping. What are you guys buying from them that you can't get 2-day shipping on?
>>53958608
Awooooga

>> No.53958649

>>53958623
ok mr broker guy who lives off commission

>> No.53958662 [DELETED] 

I was banned for making the following post, and then all of my posts were deleted, for anyone who is curious what the CORRUPT FAGGOT MODS are up to and why 4chan has turned into low IQ mainstream bullshit for Reddit politicos now. It's because CORRUPT PIECES OF SHIT are curating discussion for political pov:

>a bunch of retarded faggots learn the theory that systemic emergences can lead to inequitable outcomes
>proceed to petulantly defend the system no matter what because it's the system that gives them privilege

Sorry for talking about you and hurting your feelings, you glowfaggot pile of shit with no respect for the rights of others who is bringing your glowfaggot autocratic shadowbanning from Reddit to 4chan now. You bootlicking, powertripping fly on a faggots turd. You literally state socialist literal Nazi.

>> No.53958678

>some random dude in here says to buy trka when it was at like .2 because it'll hit .7
>throw 1k at it
>forget about it
>get a notification my limit sell activated today

And this is why I'm up 80k after an initial deposit of 500, because I take advice from 1 post by this id posters

>> No.53958682
File: 27 KB, 344x535, SIGApacifico.jpg [View same] [iqdb] [saucenao] [google]
53958682

job offer / drug test anon here. i passed the test last week and completed my first day on the new job today

cheers lads; i'm having a cold one tonight

>> No.53958695

>>53958682
Based, I told you to take it easy

>> No.53958700

>>53958682
Grats. Hopefully it will fuel your portfolio very nicely.

>> No.53958703
File: 187 KB, 500x502, 1676181586594991.jpg [View same] [iqdb] [saucenao] [google]
53958703

I'm sorry for being a retard but with oil, commodities, and food this expensive, how in the hell are they going to bring inflation down without some aggressive rate hikes or other measures?
At least Powell is doing something but I feel like Europe is just fucked with how things stand right now.
The latest statistics once again showed everything getting more expensive and core inflation showing no sings of stopping, yet people don't seem to give a crap anymore... more profit for big companies and banks while the ordinary person is getting fisted up the arse. And the worst thing is that this person won't even blame the banks.
I went to a presentation hosted by a significant bank, bunch of normies, you know the drill... and guess what? The bank made it fuckin seem like the economy was pretty alright and everything can be blamed on Putin, and they ate it all up.

>> No.53958716
File: 249 KB, 561x561, 1677099240779542.png [View same] [iqdb] [saucenao] [google]
53958716

WHERE THE HELL are my AI generated finance waifus? I'd rather have that than people arguing about BOIL all day long.

>> No.53958720

>>53958341
>nd the time you thought it was a good idea to go long SIGA spreads
yall just make shit up now?

>> No.53958733
File: 276 KB, 1000x1000, 1678064424909438.jpg [View same] [iqdb] [saucenao] [google]
53958733

>>53958678
>when it was at like .2 because it'll hit .7
>throw 1k at it
>And this is why I'm up 80k
Bruh ong this math aint mathin. That should only be a 3.5x

>> No.53958740
File: 457 KB, 2560x1707, 1663776699728853.jpg [View same] [iqdb] [saucenao] [google]
53958740

> bring inflation down
Woah hold on there hothead. I don't like this attitude. I think we should consider a possibility that i6% inflation is actually good for the economy before we do somethind stupid. I'll give more updates on this later.

>> No.53958744

>>53958678
Your math seems a little funny but I'm happy for you anon

>> No.53958748

>>53958733
>small brain detected
he's saying he makes trades like this often where he follows 1 post by this ID shills, where he throws money at ideas generated by /smg/, and that is why he is up so much

>> No.53958753
File: 3.02 MB, 2067x1236, Les Bogs 11.png [View same] [iqdb] [saucenao] [google]
53958753

>>53958703
>how in the hell are they going to bring inflation down
Stop printing money every single day (but that won't ever happen under this regime).
>>53958716
Best I can do is hook you up with them.

>> No.53958755

>>53958733
That's overall, not off of that one transaction dummy

>> No.53958760
File: 428 KB, 1242x1129, chess master.jpg [View same] [iqdb] [saucenao] [google]
53958760

>>53958649
I have no idea what you're talking about, anon...

>> No.53958768

>>53958382
Do you realize that smg rates the biggest fucking moron schizo contrarians out there? From zerohedge to Greg Marinara, smiggers have consistently latched onto retards

>> No.53958777

>>53958703
>but I feel like Europe is just fucked with how things stand right now.
They're pretty fucking dumb, I think they were anticipating a harsher winter and it didn't happen so they just got a big head

>> No.53958779

>>53958425
The white girls at sonic are not as cute as the white girls working for Target (Ticker symbol TGT)

>> No.53958780
File: 501 KB, 600x600, 1677102888065810.gif [View same] [iqdb] [saucenao] [google]
53958780

>>53958753
>Best I can do is hook you up with them
Well, if that really is the best you can do, I guess that will do. But I'm not happy about it, mind you.

>> No.53958793
File: 103 KB, 999x563, 1670256432994610.jpg [View same] [iqdb] [saucenao] [google]
53958793

>>53958780
wo(man) of culture I see

>> No.53958799

>>53958779
The cutest wagies where I live are at Chick Fil A for some reason, I live in a fairly white area though so that restaurant isn't filled with black people and I'm also not in the south

>> No.53958805
File: 38 KB, 1078x161, CRBPajeet.png [View same] [iqdb] [saucenao] [google]
53958805

>>53958720
There is evidence.

>> No.53958806
File: 147 KB, 800x800, Selena1.jpg [View same] [iqdb] [saucenao] [google]
53958806

What stocks does she own?

>> No.53958814

>>53958806
LOVE
I bet she bought it in 2020 too

>> No.53958815
File: 2.04 MB, 640x800, femalebrokerdance.webm [View same] [iqdb] [saucenao] [google]
53958815

>>53958716
Here is a live stream of my female broker dancing when she gets a juicy commission

>> No.53958817
File: 14 KB, 500x590, 1601346149138.png [View same] [iqdb] [saucenao] [google]
53958817

>>53958805
who is that. wtf kind of brokerage platform is that. i have done some retarded trades on /smg/ but anything to do with SIGA is not one of them. I was just SIGA GAY SEX BROS posting with soijaks through it all

>> No.53958836

>>53958799
The white wagie girls at Starbucks are all fat as fuck and ugly. I used to live in a super white area and the Starbucks white girls there were always like 2 standard deviations uglier.

The white girls at Applebees are fucking great though. Wild as shit. Used to fuck one with a perky ass and mild bipolar disorder who would tell me about how dysfunctional her Applebees was

>> No.53958864
File: 496 KB, 245x150, Landa.gif [View same] [iqdb] [saucenao] [google]
53958864

>>53958806
>Check her Linkedin
>Bartender, Dance Instructor, Brand Ambassador
>>53958815
Give Rogue from X-Men gf plz

>> No.53958865

>>53958753
This feels like a baggie post ... Not an insult I like baggie

>> No.53958869
File: 29 KB, 600x337, smug_kold_king.jpg [View same] [iqdb] [saucenao] [google]
53958869

lmaoing at BOIL baggies today... i guess that's why they call it the widow maker for a reason... doesn't really work if these guys are virgins though

>> No.53958889 [DELETED] 

https://archived.moe/biz/thread/53957857/#53958662

>> No.53958925
File: 739 KB, 640x895, 1677973787066620.png [View same] [iqdb] [saucenao] [google]
53958925

You. Are. Warned. The bull run. He is bringing it to your doorstep. With a side of habanero.

>> No.53958939

anybody know what they are charging at KFC for a double down?

>> No.53958948 [DELETED] 
File: 1.50 MB, 1190x1092, Screen Shot 2023-03-06 at 3.27.14 PM.png [View same] [iqdb] [saucenao] [google]
53958948

How do I profit off of police no longer returning fire?

>> No.53958995

Test

>> No.53959020 [DELETED] 

https://archived.moe/biz/thread/53957857/#53958662

>> No.53959040

BOIL BOIL BOIL
IM LIQUIDATED
I CRY AHHHHHHHHH

>> No.53959052

>>53958939
I didn't even know they still had those

>> No.53959061

>>53959040
>the widowmaker

>> No.53959072

>>53958925
Tell me about the Mango Habanero Sauce Company. Why is it at 15x Revenues.

>> No.53959100

Alright holy fuck milkbreaths. I just joined a free finance gurus discord server because my irl friend joined it and i want to see just how bad my bud is gonna get dumped on.

This options furu retard was say vanna exposure is bigger than gamma exposure in the 0DTE SPX markets(when ATM options have the biggest notional size.) he also runs a fund kek. The guy was alluding to the market being the most volatile when were in negative gamma territory but the data says otherwise(zero gamma is when markets are most volatile.)

Seems to be all the rage... self-anointed fund managers who think ... that “Theta” is the edge … or ... selling puts / buying calls creates a “Quasi-Free Call”... we should really encourage more of this. Lol.

>> No.53959112

>>53959100
do you even arbitrage bro

>> No.53959123

>>53958703
They won't. Hence why it climbed after powell lowered it to baby 25 hikes

>> No.53959127
File: 51 KB, 149x540, Holding List 2023 - Till Death.jpg [View same] [iqdb] [saucenao] [google]
53959127

Another day. Another day of green. Another day of "doing nothing" and getting paid for it. Almost had an accident this morning. Fucking almost fell on my ass over a cat toy. Was in a hurray and stepped on it. (ball). So yeah.

>> No.53959133

>>53958477
This wouldve wiped you out last week.

>> No.53959142

>>53958695
>>53958700
thanks lads
>hey bro can i borrow some clean piss

>> No.53959158
File: 201 KB, 744x536, Miu huh.jpg [View same] [iqdb] [saucenao] [google]
53959158

BOIL is so fucking flat oh my god. I dont know if this is good or bad going into the rest of the week

>> No.53959179
File: 210 KB, 1280x1352, nana_suffer.jpg [View same] [iqdb] [saucenao] [google]
53959179

I've had to do so much work over the last 2 weeks I have no clue where the market is or what it is doing.

>> No.53959185

>>53959112
bro selling SPX puts while buying SPY shares is risk free arbitrage

>> No.53959196
File: 23 KB, 474x266, 1677789887152094.jpg [View same] [iqdb] [saucenao] [google]
53959196

>>53959179
SPY will NEVER go below 393 EVER AGAIN. Hopefully you can get in on a pullback while you still can.

>> No.53959197

>>53959179
Bullshit jew market like usual

>> No.53959204

>>53958682
What fucking job are you taking that requires a piss test?

>> No.53959205 [DELETED] 

>>53959020
JANNIE THIS POST IS DANGEROUS FOR OUR DEMOCRACY JANNIIIEEE HEELLLPPP

>> No.53959209 [DELETED] 

https://archived.moe/biz/thread/53957857/#53958662

>> No.53959213 [DELETED] 

>>53959209
THEY KEEP COMING GLOWIEBROS IT'S OVER

>> No.53959225

>>53959204
>What fucking job are you taking that requires a piss test?
i sell cybersecurity to the department of defense, basically

>> No.53959232

>>53959158
braps been defeated

>> No.53959243

>>53959158
Sub 5$ by next week

>> No.53959255
File: 74 KB, 1822x370, Screenshot 2023-03-06 at 3.13.44 PM.png [View same] [iqdb] [saucenao] [google]
53959255

I think I am the least autistic smigger.

>> No.53959261 [DELETED] 

>>53959020
>>53959205
>>53959209
>>53959213
The glowniggers are using the "boiling frog" approach to slowly turn 4chan into another reddit. If they did it all at once then everyone would leave for another site.

>> No.53959275
File: 357 KB, 496x632, 7452165847608.png [View same] [iqdb] [saucenao] [google]
53959275

>>53958306
Alarm is set. Wouldn't miss it for all the tea in China.
Bananas to the moon!

>> No.53959293

>>53958817
Looking more closely, you're right. The dark theme is similar but its clearly a different platform that looks kind of mobile app inspired, whereas the DNN trade looks like some typical desktop-based platform such as tastytrade. As an IBKR user myself, all I can say with confidence is that it's not the TWS platform.
I've always thought that SIGA trade must've been you. Managing to lose money with complex option spread plays against a simple pump and dump feels like such a typical 150 iq jeet play that I just assumed it was you.

I was going to apologize, but in looking more closely there are glaring issues with the DNN trade screenshot. P/L Open is listed twice and P/L Day has the same value. DNN hasn't traded above $1.70 since last April and yet the screenshot is marked with today's date. The P/L numbers and percentage only add up if using DNN's Friday close as the reference present day share price, and shorting exactly 19005 shares is pretty odd in itself. So on the whole, that's either a really garbage platform and using outdated data, or the whole screenshot is a forgery.

>> No.53959316

>>53959225
and you must piss over it for it to work thus requiring pure urine?

>> No.53959329

>>53959316
its just a standard drug test that alot of corporate jobs require before hiring you

>> No.53959336

>>53958425
>these guys don't seem to be public
Just like Chick-fil-A, maybe not letting (((shareholders))) control your company is a good thing

>> No.53959362 [DELETED] 

>>53959261
I do it as a meta troll and because the shitposters are all extremely bad.

>> No.53959368

>>53959329
so what do you piss on in that job?

>> No.53959378

>>53959052
Just got released today for 4 weeks

>> No.53959379 [DELETED] 

>>53959261
You're a couple years too late

>> No.53959407
File: 466 KB, 800x800, easy.jpg [View same] [iqdb] [saucenao] [google]
53959407

>check muh BOIL just bought today
>up over 4% in the after hours

>> No.53959410

>>53959368
bro. you go to labcorp and piss in the cup and they test it to make sure you're not a drug addict before hiring you. stop trolling

>> No.53959418
File: 1.21 MB, 840x840, 23874658926735.png [View same] [iqdb] [saucenao] [google]
53959418

>> No.53959432

>>53959293
>NN hasn't traded above $1.70 since last April and yet the screenshot is marked with today's date.
Anon. That is when the trade was opened (to sell)

>> No.53959437

>>53959196
But you're saying it'll go to 393, giggity

>> No.53959442

>>53959407
Falling knives, widow makers, etc

>> No.53959453

Holy fucking shit, just opened /BBBY/ general it reminded me of Jan 2021. These people are still talking about dark pools, barcoding, synthetic naked shorting, etc

>> No.53959473
File: 720 KB, 800x868, 1668699935549522.png [View same] [iqdb] [saucenao] [google]
53959473

Have you guys calmed down yet?

>> No.53959485

>>53957625
>Adolescents with an IQ of 130 were 3-5 times less likely to have had intercourse
Wow she's literally talking about me fr fr.

>> No.53959491
File: 82 KB, 910x1024, 1675535860311172.jpg [View same] [iqdb] [saucenao] [google]
53959491

>>53959473
no

>> No.53959496
File: 1.06 MB, 1732x1317, WJC.jpg [View same] [iqdb] [saucenao] [google]
53959496

>>53959491
It was wild in here earlier.

>> No.53959501

>>53959442
I will hold till next Winter if need be, and add to it along the way any chance I am able during dips. Then when it moons I will sell and start trying to determine when to buy KOLD. I hope at some point to build up enough to do essentially the same thing with options because I need to leverage my little seed, I am way too old and in straits too dire for waiting on Bogleism.

>> No.53959525
File: 31 KB, 402x604, fatboi.jpg [View same] [iqdb] [saucenao] [google]
53959525

>futures
https://www.youtube.com/watch?v=mMI6ewAkOtY

>> No.53959532

>>53959410
>we just need your piss goyim
>for r- research purpose and shieeet
some white underage girl is drowned with your piss at the nearest freemason lodge

>> No.53959547

Anyone longing PISS?

>> No.53959550

>>53959532
I would be into donating my piss for this very purpose. Where do I sign up and how do I know it isn't going to be used by some Buffalo Bill type instead?

>> No.53959556

>>53959209
I got banned for saying "The most Jreidh thing I ever done is own bank stocks and profit on the downfall of America". The Mods must not be Kanye fans

>> No.53959593

what is it with titlets and crop tops

>> No.53959627

>>53959432
>Anon. That is when the trade was opened (to sell)
Yes. I am aware.
( 1.77 - 1.23 ) x 19005 = 10262.7
Plug in 1.27 - friday's close - and you get 9312.45. However, the screenshot taken at 1:13 PST is after Monday's close. And all of this is P/L info before share borrow fees of course.

Daily P/L columns typically show profit/loss from movements during the current day. And none of this explains why someone would create a view that displays the same column twice.

Mysterious. Your nitpicking of a single sentence only further adds to the mystery.

>> No.53959660
File: 55 KB, 736x620, 1674956465506013.jpg [View same] [iqdb] [saucenao] [google]
53959660

JEPI and SPXS!

>> No.53959661

>>53959275
bj class, right?
do roasties really?

>> No.53959664

>>53959255
Link?

>> No.53959665 [DELETED] 

I was banned for making the following post, and then all of my posts were deleted, for anyone who is curious what the CORRUPT FAGGOT MODS are up to and why 4chan has turned into low IQ mainstream bullshit for Reddit politicos now. It's because CORRUPT PIECES OF SHIT are curating discussion for political pov:

>a bunch of retarded faggots learn the theory that systemic emergences can lead to inequitable outcomes
>proceed to petulantly defend the system no matter what because it's the system that gives them privilege

Sorry for talking about you and hurting your feelings, you glowfaggot pile of shit with no respect for the rights of others who is bringing your glowfaggot autocratic shadowbanning from Reddit to 4chan now. You bootlicking, powertripping fly on a faggots turd. You literally state socialist literal Nazi.

>> No.53959680 [DELETED] 
File: 112 KB, 1752x834, 1675725325827897.jpg [View same] [iqdb] [saucenao] [google]
53959680

>>53959665
JFC a one man holocaust.

>> No.53959682

>>53959496
Wtf is this real

>> No.53959683

>>53959660
This doesn't actually sound like a terrible combination

>> No.53959693

Baking.

>> No.53959701

Now a good time to swing about a grand er nah?

>> No.53959711
File: 800 KB, 500x545, dere.gif [View same] [iqdb] [saucenao] [google]
53959711

>>53959683
lost money chasing options, and now i'm busier than usual at work. still bearish and all signs point toward a coming "crash". it just makes sense for me to just DCA into those 2 for the time being.

>captcha: prayxp

>> No.53959714
File: 1.45 MB, 1440x1446, 1662004365749984.png [View same] [iqdb] [saucenao] [google]
53959714

>>53959682
Google Earth Pro. It's a fun program.

>> No.53959720

>>53959660
I sold my SPXS last week and bought JEPI. Today I sold JEPI at $54.20 in anticipation of JPow's jawboning session with the Senate tomorrow. It should be a good time, I will sit in cash until a good direction can be identified. At least cash is yielding an annualized 4.5%

>> No.53959721

>>53959701
BOIL BOIL BOIL
FUCK
IM DONE FOR
I AM A BAGGIE FOR LIFE
WAHHHHH BABY CRY

>> No.53959727

>>53959721
Someone get this hothead outta here!

>> No.53959732

What are you guys shorting going into the weeks leading to the FOMC?
Tech is obvious enough ig.
Seems dumb not to take advantage of euphoric bullmutts pumping it to extremes. Also I claim first usage of "bullmutts" , I license it for use through an open creative commons license.

>> No.53959739 [DELETED] 
File: 54 KB, 871x268, janny.jpg [View same] [iqdb] [saucenao] [google]
53959739

>>53959665
Sometimes you catch a bullshit ban. Unlucky. Complain all you want but it's not going to change anything. Your spam will only lead to some innocent city getting rangebanned.

>> No.53959741

>>53959721
I want to stop being a baggie.

>> No.53959755

>>53959496
Ahh, DC. Last time I was there I was breaking into the Capitol!

>> No.53959759

>>53959721
I wish I could buy more.

>> No.53959768

>>53959682
>>53959496
wtf am I missing here?
what city is this a pic of? why is it surprising that this is real?

>> No.53959772 [DELETED] 

>>53959739
I am permab& on my main. I would like to slice gookmoot and his buttboy mods open and take a dump where their brains are supposed to be. https://vocaroo.com/1dmb0PiAqesv

>> No.53959780 [DELETED] 

Oh wow yeah instead getting rid of the abusive shithead mod just threaten us with making the website suck even more dick

I was banned for making the following post, and then all of my posts were deleted, for anyone who is curious what the CORRUPT FAGGOT MODS are up to and why 4chan has turned into low IQ mainstream bullshit for Reddit politicos now. It's because CORRUPT PIECES OF SHIT are curating discussion for political pov:

>a bunch of retarded faggots learn the theory that systemic emergences can lead to inequitable outcomes
>proceed to petulantly defend the system no matter what because it's the system that gives them privilege

Sorry for talking about you and hurting your feelings, you glowfaggot pile of shit with no respect for the rights of others who is bringing your glowfaggot autocratic shadowbanning from Reddit to 4chan now. You bootlicking, powertripping fly on a faggots turd. You literally state socialist literal Nazi.

>> No.53959782

>>53958682
Celebrate with a little bit of chicken fried

>> No.53959791
File: 906 KB, 720x720, doom_paul_1.png [View same] [iqdb] [saucenao] [google]
53959791

I'm actually now slightly concerned all of you have gone funny in the head because of some astrology bullshit.

>> No.53959797
File: 44 KB, 220x225, 1674502404134286.gif [View same] [iqdb] [saucenao] [google]
53959797

JPOW fucking my shit on wens?

>> No.53959798

>>53959772
KEK!!!

>> No.53959803

>>53959759
of what?

>> No.53959808

>>53959732
These...
>>53958149

As for tech, I do have EBAY, but there's too much emotion and bulltards behind most of the other stupid tech stocks (that absolutely are ridiculously overvalued). Best to short stocks that are out in the periphery and in the shadows, away from the prying eyes of retarded FOMO bulls. That being said, when reddit tech bulls are finally shaken out of the market, I might go long TECS 3x leveraged inverse Tech ETF.

>> No.53959817

>>53959803
uh...BOIL?

>> No.53959832
File: 123 KB, 1000x1000, 1676219259963635.jpg [View same] [iqdb] [saucenao] [google]
53959832

>>53959473
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

>> No.53959845
File: 135 KB, 1200x676, 1671210111852191.jpg [View same] [iqdb] [saucenao] [google]
53959845

>>53959797
Jerome speaks tomorrow

>> No.53959846 [DELETED] 

Execute gookmoot and the biz mod in the most violent and painful way possible, I hate these bastards so much

>> No.53959850
File: 8 KB, 244x207, Science Apu.jpg [View same] [iqdb] [saucenao] [google]
53959850

>>53959791
If we consider /smg/ a homogeneous mixture of sane-ish normies and hardcore schizos, we can model a "boil off" scenario wherein market crashes followed by bullshit crab markets where nothing happens cause normies to leave. This kicks off a feedback loop of higher thread schizo content driving off more normies. Which all leaves /smg/ with a higher and higher proportion of schizos.

Which is to say this is a bottom signal. Long TQQQ.

>> No.53959867
File: 28 KB, 750x440, DE093E06-E3D0-4232-9F16-F14680B80123.jpg [View same] [iqdb] [saucenao] [google]
53959867

3 figure hell 3 figure hell
boil boil boil
My blood boils
A baggie for life a baggie for like
3 FIGUEr hell

>> No.53959874
File: 244 KB, 752x575, Peter Lynch thinking.png [View same] [iqdb] [saucenao] [google]
53959874

>>53959850
This is astoundingly plausible.

>> No.53959880 [DELETED] 
File: 138 KB, 720x1146, Screenshot_20230217-165353_Photos.jpg [View same] [iqdb] [saucenao] [google]
53959880

>>53959780
I like to post my softcore lewds to trigger the fatties and "hamchads" around here but the problem is the jannies seethe too and ban me for posting them. Gym gains are the only gains the jews can't steal from you.

Buy more BOIL

>> No.53959890

>>53959850
Hey mumu, how about you cut off the fancy speak and start grabbing ankles for JPow's massive "tools"? You like that, mumu??

>> No.53959919
File: 28 KB, 383x383, Science Pepe at Meme State University.jpg [View same] [iqdb] [saucenao] [google]
53959919

>>53959890
Jerome Powell is bitchmade. Did you not notice him pussy out about financial conditions not once but twice the last couple pressers?

Most likely we rally on the removal of event risk. Outside chance we rally strongly when he begins talking about QE for climate change and reparations bonds.

>> No.53959940
File: 124 KB, 498x337, 1674776380699151.png [View same] [iqdb] [saucenao] [google]
53959940

>>53959890
shoo Morgan Stanley analyst shoo

>> No.53959954

Are pair trades a meme?

>> No.53959981

>>53959954
Everything is a meme.

>> No.53959992

Reminder that oil just broke above 80, which means it's going to do another autistic dump back to the low 70s.

>> No.53960014
File: 267 KB, 1000x1500, IMG_4257-e1426266095441-1000x1500.jpg [View same] [iqdb] [saucenao] [google]
53960014

>>53959992
Maybe. But rigs are bit down and demand is picking up now from Chyna. But Im not sure its going to hit $90 from here before coming down.

>> No.53960013

Execute gookmoot and his buttboy biz mod with fire

>> No.53960016
File: 1.36 MB, 640x358, 1629915911676.gif [View same] [iqdb] [saucenao] [google]
53960016

>>53959850
I'm not a schizo. I'm a clairvoyant. Big fan of schizos tho.

>> No.53960018

>>53959954
Good luck identifying them. Pair trading isnt something done browsing through charts on WeBull, its done by the millisecond by Hedge Fund arbitrage-hunting algos.

>> No.53960040
File: 115 KB, 351x310, 1656655782379.png [View same] [iqdb] [saucenao] [google]
53960040

Bros, my fever has gone down finally. Hopefully I can go to the market tomorrow
I checked and today I made $300, which is nice I guess

>> No.53960048
File: 1.18 MB, 1080x1324, 1669591411623715.jpg [View same] [iqdb] [saucenao] [google]
53960048

Hi niggers I'm back after my 2 week hiatus. Not trading has made me happy and soft, ended up failing an exam today. So from tomorrow, I'm going back in. So what's it gonna be tomorrow, 0dte calls or puts?

>> No.53960067

l-arginine
zinc
anything else i should take for god tier cooms? drinking lots of water too

>> No.53960077

>>53960067
I just shat a big ass log into my toilet bowl.
mix of fards and shids
felt wonderful

>> No.53960082

>>53960067
Pineapple,
do kegals
hip thrust
glute splits
uhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh I think blue balling and edging help but im not too sure : l

>> No.53960083

>>53960077
Based.

>> No.53960084

>>53960048
Both, its crab season.

>> No.53960107 [DELETED] 

>>53960098
>>53960098
>>53960098

>> No.53960117

early bakers is kill

>> No.53960118
File: 10 KB, 274x274, 1614870474685.jpg [View same] [iqdb] [saucenao] [google]
53960118

>>53960107
TOO SOON REEEEE!!!!!

>> No.53960132

>>53960040
That's very nice, both that you are getting better, and that you made $300. My entire portfolio is $260.79. I made $1.49 during market hours, but down 70 cents in the after hours.

>> No.53960143

>>53959768
It's Washington DC. The other posts, idk, I waged today. It's not surprising that it's real, they're just seeing if you're new. You took the bait.

>> No.53960151 [DELETED] 

NEW
>>53960142
>>53960142
>>53960142
>>53960142

>> No.53960154

>>53960107
They 404'd it, but I'd like to see the pic.

>> No.53960161

>>53960018
Tons of alpha in random ass non-fundamental pure correlation pairs trades. Like stocks or baskets that are not even remotely related to each other. its pure alpha. and yes you're right, none of us on smg are gonna be able to do this lol. i know a signal processing nerd who does this shit, he makes me look like a SOXL tard

>> No.53960166

>>53960151
Also premature.

>> No.53960168

>>53960154
no, we can't post Jpow with boobies nooooo that would be terrible haha

>> No.53960169
File: 284 KB, 680x680, 1618672588117.png [View same] [iqdb] [saucenao] [google]
53960169

>>53960151
HE DID IT AGAIN!!!! REEEEEEE!!!!

>> No.53960193

Baking.

>> No.53960211

TOO MANY BAKINGS
TOO MANY BAKINGS
AAAAAAAAAAAAAAAAAAA

>> No.53960215

So Toyota
>doesn't comply with the left for jumping the gun on EV motors like the rest of the car manufacturers, so they can study the new technology further
>gets attacked by the left for not doing so
>even though they are still having good years in sales and still one of the best car manufacturers in the world (if not the best) with good reliability and handling their stock price tanks
>CEO steps down to become chairman
What are the odds that big wallstreet are the reason their price is tanking because they aren't aligning themselves with woke issues (ESG type shit) even though they are still having amazing sales? Do you think their stocks will raise back up with the new CEO?

>> No.53960230

holy shit
so many deleted posts in this thread.
is scoopsies posting loli cunny again?

>> No.53960240

>>53960215
I thought they were leaning into Hydrogen because the Jap government was into it in a big way.

>> No.53960251

>>53960215
Doesn't Toyota have a hybrid? IMO that is by far the most sensible next step for quite some while. I know someone that has a hybrid, which I think is a Toyota, and it gets excellent gas mileage, the engine keeps the EV part charged, and it has lasted 400,000 miles so far and no major surgery required.

>> No.53960259

>>53960215
Theyre one of the few companies with a functioning hydrogen vehicle(mirai). They need a hybrid taco, that shit would sell gangbusters I tells ya.

>> No.53960281

>>53960215
ESG is a cancer on the world, our only hope is that bullshit dies after a giant crash

>> No.53960294

>>53960215
Their stock dumped with just about everyone else as inflation story line kicked in. But I think they or another big asian admitted the 100% ev by 2030 isnt possible.

>> No.53960311

Glowniggers hate it when you discuss their subversion campaign on 4chan. How do I profit from this?

>> No.53960322

>>53960240
I think they were experimenting with alternative solutions because EV isn't fully tested and the former CEO stated that he thinks EV is untested technology that could end up being worse in the long run. And for what it's worth I think that's safe to say, considering Tesla has had an insane amount of issues over the years.

>>53960251
>>53960259
They have a shitton of hybrids and yeah they are some of the best cars in the world. Pretty sure the Prius was the first ever hybrid even. But they are getting their ass slammed by woketards. There have been protests, social media raids, there is a "company" called Public Citizen that has been going around to Toyota events crashing them, they spam call their phone lines thousands of times, etc. And the company has received the lowest score in the environmental awareness or whatever category 2 years now.
https://www.youtube.com/watch?v=tpXwCYtIOIM
This video goes over a lot of it and it's made me really think, considering there are plenty of stocks and even crypto in recent years which seem like the price isn't actually being moved by the people but is being manipulated by big market makers on wall street. It feels like they are being targeted to try and "cancel" them until they go full EV.

>> No.53960343

>>53960311
become a glowie so you can get paid for inane posts instead of doing them for free?

>> No.53960377
File: 73 KB, 576x328, 1672962376154416.png [View same] [iqdb] [saucenao] [google]
53960377

We're apparently all a little mad here.

>> No.53960379

>>53960322
>They have a shitton of hybrids
No one makes a hybrid truck yet, or ev for that matter but ev trucks are fucking stupid.

>> No.53960393

>>53960379
At least Toyota stands toe to toe with Ford with their trucks. There was a dude who drove his Toyota for over 1 million miles and broke a record, so they gave him a new 2016 model for free.

>> No.53960446

>>53959040
why are you investing in a leveraged etf?

>> No.53960470

>>53960322
That was a pretty fascinating video, I didn't know much of that at all. I wouldn't have an all EV other than as a gift that I could sell.

>> No.53960476
File: 19 KB, 399x225, 1648827619484.jpg [View same] [iqdb] [saucenao] [google]
53960476

OP fucked up the links
>GG
not baking til 380

>> No.53960490

>>53960470
I do hope their price rises now though, down 12% in 5 years, if they go back up would be a great price to get in at.

>> No.53960506

>>53960470
>>53960490
1 year*
And yeah Scotty is great

>> No.53960508

>>53960490
Maybe it will moon on the first news of an EV running out of charge in Compton.

>> No.53960522
File: 116 KB, 1280x720, borat.jpg [View same] [iqdb] [saucenao] [google]
53960522

Baking NOT.

>> No.53960587

Last SMG thread

>> No.53960604
File: 162 KB, 960x870, How do skeletons have hair.jpg [View same] [iqdb] [saucenao] [google]
53960604

Dead market
Dead posters
Dead thread

>> No.53960667

>>53959593
tummies

>> No.53960671
File: 82 KB, 300x252, 1675746117950647.png [View same] [iqdb] [saucenao] [google]
53960671

>>53960604
Man, remember Goosebumps? Do kids even read anymore?

>> No.53960678

>>53960671
https://www.youtube.com/watch?v=RySHDUU2juM

>> No.53960696

>>53960671
I am hoping the whole diary of a wimpy kid stuff has finally been flushed at long last at least.

>> No.53960702
File: 96 KB, 750x719, 1677037207510125.jpg [View same] [iqdb] [saucenao] [google]
53960702

I've never had sex.

>> No.53960711
File: 43 KB, 750x539, 23 and nothing.jpg [View same] [iqdb] [saucenao] [google]
53960711

>>53960702
IT HURTS THIS IMAGE HURTS HBGEACASUR IMA A zOOORMERN VagdsafnhjafhbjkaeSDGFHJVAWEYJU FGKHdewhybgfjbhvzsdfghbjvadsfjvghabvghjdsfvhjaer

>> No.53960719

U KNOW THE DRILL

>>53960712
>>53960712
>>53960712
>>53960712