[ 3 / biz / cgl / ck / diy / fa / ic / jp / lit / sci / vr / vt ] [ index / top / reports ] [ become a patron ] [ status ]
2023-11: Warosu is now out of extended maintenance.

/biz/ - Business & Finance


View post   

File: 978 KB, 1080x2246, Screenshot_2020-02-01-22-14-55-843_com.brave.browser.jpg [View same] [iqdb] [saucenao] [google]
17063323 No.17063323[DELETED]  [Reply] [Original]

Oy veyy

>> No.17063379

>>17063323

Shieeet nigga, we screwed!

>> No.17063433
File: 30 KB, 600x600, 1503475212497.jpg [View same] [iqdb] [saucenao] [google]
17063433

honestly just dont care anymore

>> No.17063476
File: 611 KB, 2440x1258, Screen Shot 2020-02-01 at 9.50.12 PM.png [View same] [iqdb] [saucenao] [google]
17063476

>>17063323
I just blasted the nucleotides he was talking about, verdict false

>> No.17063479

>>17063476
whoa we got a biologist here

>> No.17063481

>>17063323
traffic accident?

>> No.17063483
File: 66 KB, 421x512, ahhhhhhhh.png [View same] [iqdb] [saucenao] [google]
17063483

why is this thread so fucking shit

>> No.17063565
File: 430 KB, 686x526, 1580517712234.png [View same] [iqdb] [saucenao] [google]
17063565

>>17063323
is something happening outside? how interesting for you all

>> No.17063799
File: 6 KB, 600x300, Dot-Plot.png [View same] [iqdb] [saucenao] [google]
17063799

>>17063476
https://jameslyonsweiler.com/wp-content/uploads/2020/01/inserted-portion.txt

yeah fuck you

>> No.17063816

There are legitimate foreign (and domestic) intelligence agents shilling their respective narratives on this board. It's all so tiresome. NASDAQ will close green Monday.

>> No.17064032
File: 524 KB, 2386x1080, Screen Shot 2020-02-01 at 11.43.18 PM.png [View same] [iqdb] [saucenao] [google]
17064032

>>17063799
Ok I took your sequence and translated it
>MESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVG
Blasted the protein, pic related.

>> No.17064054

>>17063816

Coronavirus is only going to get bigger. We haven’t seen anything yet.

>> No.17064307

>zero
>fucking
>hedge

>> No.17064319

>>17064054
it's all so tiresome
why can't we just make it and live the good life

>> No.17064320

>>>/pol/
this has nothing to do with /biz/

>> No.17064603
File: 43 KB, 749x536, 1580589368592.jpg [View same] [iqdb] [saucenao] [google]
17064603

when a superpower speaks, you listen

>> No.17065451

>>17063565

based comfy neet

>> No.17065482

>>17064603
Poo in the loo ftw

>> No.17065533

>>17064603
Superpooper is right sirs